KEGG   Streptococcus pneumoniae JJA: SPJ_2061Help
Entry
SPJ_2061          CDS       T00873                                 

Definition
alcohol dehydrogenase, zinc-containing
Orthology
K18369  
alcohol dehydrogenase [EC:1.1.1.-]
Organism
sjj  Streptococcus pneumoniae JJA
Pathway
Propanoate metabolism
Brite
KEGG Orthology (KO) [BR:sjj00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    SPJ_2061
Enzymes [BR:sjj01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.-  
     SPJ_2061
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1916693..1917751)
Genome map
AA seq 352 aa AA seqDB search
MKAYTYVKPGLASFVDVDKPVIRKPTDAIVRIVKTTICGTDLHIIKGDVPTCQSGTILGH
EGIGIVEEVGEGVSNFKKGDKVLISCVCACGKCYYCKKGIYAHCEDEGGWIFGHLIDGMQ
AEYLRVPHADNTLYHTPEDLSDEALVMLSDILPTGYEIGVLKGKVEPGCSVAIIGSGPVG
LAALLTAQFYSPAKLIMVDLDDNRLETALSFGATHKVNSSDPEKAIKEIYDLTDGRGVDV
AIEAVGIPATFDFCQKIIGVDGTVANCGVHGKPVEFDLDKLWIRNINVTTGLVSTNTTPQ
LLKALESHKIEPEKLVTHYFKLSEIEKAYEVFSKAADHHAIKVIIENDISEA
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcctatacttatgttaaaccaggacttgcttcttttgttgatgtagacaaacca
gttattcgcaagccaacagacgctattgtgcgtattgtaaaaaccactatttgtggaaca
gacctccatattatcaaaggggatgttcctacttgccaaagtggtaccattcttggccac
gaagggattgggattgttgaagaagttggggaaggagtttccaacttcaaaaaaggcgac
aaggtcttgatttcttgcgtctgtgcctgtggtaaatgctactactgtaaaaaaggaatt
tatgcccactgtgaagacgaagggggctggattttcggtcacttgattgatggtatgcag
gctgaatatctacgtgtccctcatgcagataatactctttaccatactccagaagacttg
tcagatgaagctttggttatgctgtcagacattctgcctactggatatgaaattggtgtc
ttaaaagggaaagtagaacctggttgcagcgtagccattattggttcaggtccagttgga
ttggctgctcttttaacagcccaattctattcaccagctaaattgattatggtagaccta
gacgataaccgcttggaaactgccctatcattcggtgcgactcataaggttaattcttca
gaccctgaaaaagccattaaagaaatttatgatttgacagatggtcgtggtgtggatgtc
gctatcgaagctgttggtattcctgcaacatttgatttctgtcaaaagattatcggtgta
gacggaacggttgccaactgtggtgtgcatggtaaaccagttgaattcgatttagataaa
ctttggattcgcaacatcaatgtaacaactggtttggtatctacaaatacgactccacaa
ttgttgaaagcacttgaaagtcataagattgaaccagaaaaattggtaactcactatttc
aaactcagtgaaattgaaaaagcctatgaagtcttcagtaaggcagcagaccaccatgcc
attaaggtcattatcgaaaacgatatctcagaagcctaa

DBGET integrated database retrieval system