KEGG   Streptococcus pneumoniae JJA: SPJ_2072Help
Entry
SPJ_2072          CDS       T00873                                 

Gene name
thrC
Definition
threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
sjj  Streptococcus pneumoniae JJA
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:sjj00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    SPJ_2072 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SPJ_2072 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    SPJ_2072 (thrC)
Enzymes [BR:sjj01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     SPJ_2072 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1928402..1929886)
Genome map
AA seq 494 aa AA seqDB search
MTLVYQSTRDANNTVTASQAILQGLATDGGLFTPDTYPKVDLNFDKLKDASYQEVAKLVL
SAFLDDFTVEELDYCINNAYDSKFDTPAIAPLVKLDGQYNLELFHGSTIAFKDMALSILP
YFMTTAAKKHGLENKIVILTATSGDTGKAAMAGFANVPGTEIIVFYPKDGVSKIQELQMT
TQTGDNTHVIAIDGNFDDAQTNVKHMFNDVALREKLTTNKLHFSSANSMNIGRLVPQIVY
YVYAYAQLVKTGEIVAGEKVNFTVPTGNFGNILAAFYAKQIGLPVGKLICASNDNNVLTD
FFKTRVYDKKREFKVTTSPSMDILVSSNLERLIFHLLGNNAEKTTELMNALNTQGQYKLT
DFDAEILDLFAAEYATEEETAAEIKRVCELDSYIEDPHTAVASAVYKKYQSATGDVTKTV
IASTASPYKFPVVAVEAVTGKAGLTDFEALAQLHEISGVAVPPAVDGLEIAPIRHKTTVA
AADMQAAVEAYLGL
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atgacattagtttatcaatcaacgcgtgatgccaacaatacagtaactgccagccaagca
attttgcaaggtttggcgacggacggcggtttgtttacaccggatacttatccaaaggta
gatttgaactttgacaaattgaaagatgcttcttaccaggaagttgctaagctagttttg
tcagcatttttagatgactttacagttgaggagttggactactgtatcaacaatgcctac
gatagcaaatttgatactccagctattgcaccattagtgaaattagatgggcaatacaat
ttggaacttttccatggttcaacgattgcctttaaggatatggccttgtctattttgcca
tactttatgacgactgctgctaagaaacatggtttggagaacaagattgttatcttgaca
gcgacatctggtgacacggggaaagctgctatggcggggtttgcgaatgtgcctggtact
gagattatcgtcttttatccaaaggatggtgtcagcaagattcaagagttacaaatgacc
actcagactggcgacaatactcatgttattgctattgatggtaactttgacgatgcgcaa
acaaatgtgaagcacatgtttaacgacgtggctcttcgtgaaaaattgactaccaacaag
ttgcacttttcatcagctaactctatgaacattggtcgtctggtgccacaaattgtttat
tatgtttatgcttacgctcaattggttaagactggtgaaattgtagctggtgaaaaggtt
aacttcacagtaccaacaggaaactttggaaatatcttggctgccttttatgccaaacaa
attggtttgccagttggtaaattaatctgtgcttcaaatgacaacaatgttttgacagac
ttctttaaaacacgtgtctatgacaaaaaacgtgagtttaaggtaacaaccagcccatct
atggatatcttggtatcttcaaacttggagcgcttgattttccatcttttgggaaataat
gctgaaaagacaactgaacttatgaatgccttgaacacgcaaggacaatataagttgaca
gactttgatgcagagattttggacctctttgcagctgaatatgcgactgaggaagaaacg
gcagcagagatcaagcgtgtttgtgagttagattcttatatcgaggaccctcatacagct
gttgcttcagcagtttataaaaaataccaatcggccactggagatgtaactaagacagtg
attgcttcaacagctagtccatacaagttcccagtagttgcagtagaagctgtaactgga
aaagcaggtttaacagactttgaagccttggctcaattacatgaaatctcaggcgttgca
gtgccaccagcagttgatgggcttgaaatagctccaattcgtcacaagacaacagtggca
gctgctgacatgcaagcagcggttgaggcttatttaggactttaa

DBGET integrated database retrieval system