KEGG   Streptococcus pneumoniae JJA: SPJ_2091Help
Entry
SPJ_2091          CDS       T00873                                 

Gene name
gltX
Definition
glutamyl-tRNA synthetase (EC:6.1.1.17)
Orthology
K09698  
nondiscriminating glutamyl-tRNA synthetase [EC:6.1.1.24]
Organism
sjj  Streptococcus pneumoniae JJA
Pathway
Aminoacyl-tRNA biosynthesis
Metabolic pathways
Module
Aminoacyl-tRNA biosynthesis, prokaryotes
Class
Genetic Information Processing; Translation; Aminoacyl-tRNA biosynthesis [PATH:sjj00970]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1938153..1939613)
Genome map
AA seq 486 aa AA seqDB search
MSKDIRVRYAPSPTGLLHIGNARTALFNYLYARHHGGTFLIRIEDTDRKRHVEDGERSQL
ENLRWLGMDWDESPESHENYRQSERLDLYQKYIDQLLAEGKAYKSYVTEEELAAERERQE
VAGETPRYINEYLGMSEEEKAAYIAEREAAGIIPTVRLAVNESGIYKWHDMVKGDIEFEG
GNIGGDWVIQKKDGYPTYNFAVVIDDHDMQISHVIRGDDHIANTPKQLMVYEALGWEAPE
FGHMTLIINSETGKKLSKRDTNTLQFIEDYRKKGYLPEAVFNFIALLGWNPGGEDEIFSR
EELIKLFDENRLSKSPAAFDQKKLDWMSNDYIKNADLETIFEMAKPFLEEAGRLTDKAEK
LVELYKPQMKSVDEIIPLTDLFFSDFPELTEAEREVMTGETVPTVLEAFKAKLEAMTDDE
FVTENIFPQIKAVQKETGIKGKNLFMPIRIAVSGEMHGPELPDTIFLLGREKSIQHIENI
LKEISK
NT seq 1461 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaaagatatccgcgtacgttacgcaccaagtccaacaggactactacacatcgga
aatgcccgtacagcattgtttaactacttgtatgcgcgccatcatggtggaacatttctc
atccgtatcgaagatactgaccgtaaacgccatgtcgaggatggtgaacgttcacaactt
gaaaaccttcgctggttaggcatggattgggatgaaagtccagaatcacatgagaattat
cgccagtctgagcgtttggacttgtatcaaaaatacattgaccaactattagctgaagga
aaagcctataaatcttacgttacagaagaagagttggcagctgaacgtgaacgtcaagaa
gtagctggcgaaacaccacgctacatcaatgaataccttggtatgagtgaagaagaaaaa
gcggcttatatcgcagaacgtgaagcagctggtatcataccaacagttcgtttggctgtc
aatgagtcaggtatctacaagtggcatgatatggtcaaaggtgatatcgaatttgaaggt
ggcaatatcggcggtgactgggttatccaaaagaaagacggttacccaacttacaacttt
gccgttgttatcgatgaccacgatatgcaaatctctcatgttatccgtggagatgaccat
attgctaatacaccaaaacagcttatggtctatgaagctcttggttgggaagctccagag
tttggtcacatgaccttgattatcaactctgagactggtaagaagttatctaaacgtgat
actaatacacttcaatttatcgaagattaccgaaagaaaggttaccttccagaagcagtc
tttaactttattgctcttcttggttggaacccaggtggtgaagatgagattttctctcgt
gaagaactcattaaactttttgatgaaaaccgcctcagcaagtcaccagcagcctttgat
cagaaaaaattagactggatgagcaatgattatatcaagaatgcagaccttgaaaccatc
tttgaaatggcaaaaccattcttagaggaagcaggccgtttgactgacaaggctgaaaaa
ttagttgagctctataaaccacaaatgaaatcagtagatgagattatcccattgacagat
cttttcttctcagatttcccagaattgacagaagcagagcgcgaagtcatgacgggtgaa
acagttccaacagttcttgaagcattcaaagcaaaacttgaagcgatgacagatgatgaa
tttgtgacagaaaatatcttcccacaaattaaagcagtccaaaaagaaacaggtattaaa
gggaaaaatcttttcatgcctattcgtatcgcagtttcaggcgaaatgcatgggccagaa
ttaccagatacaattttcttgcttggacgtgaaaaatcaattcagcatatcgaaaacatt
ctaaaagaaatctctaaataa

DBGET integrated database retrieval system