KEGG   Streptococcus pneumoniae JJA: SPJ_2128Help
Entry
SPJ_2128          CDS       T00873                                 

Gene name
malQ
Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
sjj  Streptococcus pneumoniae JJA
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:sjj00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1978444..1979961)
Genome map
AA seq 505 aa AA seqDB search
MKKRQSGVLMHISSLPGAYGIGSFGQSAYDFVDFLVRTKQRYWQILPLGATSYGDSPYQS
FSAFAGNTHFIDLDILVEQGLLEASDLEGVDFGSDASEVDYAKIYYARRPLLEKAVKRFF
EVGDVKDFEKFAQDNQSWLELFAEYMAIKEYFDNLAWTEWPDADARARKASALESYREQL
ADKLVYHRVTQYFFFQQWLKLKAYANDNHIEIVGDMPIYVAEDSSDMWANPHLFKTDVNG
KATCIAGCPPDEFSVTGQLWGNPIYDWEAMDKDGYKWWIERLRESFKIYDIVRIDHFRGF
ESYWEIPAGSDTAAPGEWVKGPGYKLFAAVKEELGELNIIAEDLGFMTDEVIELRERTGF
PGMKILQFAFNPEDESIDSPHLAPANSVMYTGTHDNNTVLGWYRNEIDDATREYMARYTN
RKEYETVVHAMLRTVFSSVSFMAIATMQDLLELDEAARMNFPSTLGGNWSWRMTEDQLTP
AVEEGLLDLTTIYRRINENLVDLKK
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaacgtcaaagtggtgtgttgatgcacatctcttctcttccaggagcttacgga
atcggatcatttggtcaaagtgcttacgacttcgttgatttcttggtccgtacaaaacaa
cgttactggcaaatccttccattaggagcaactagttacggggattctccttaccaatct
ttctcagccttcgcaggaaacactcattttatcgatttagatatcttggtggagcaaggt
ttgttggaagcaagtgaccttgaaggagttgactttggtagcgatgcgtctgaagttgac
tatgctaaaatctactatgcacgtcgtcctcttttagaaaaagcggtgaaacgtttcttt
gaagtcggagatgttaaagattttgagaaatttgctcaagacaaccaatcatggcttgag
ctctttgctgagtatatggctatcaaagagtattttgacaatcttgcttggactgaatgg
ccagatgcagatgctcgtgctcgtaaagcttcagcacttgaaagctatcgtgagcaattg
gcagacaagttggtttaccaccgtgtgactcaatacttcttcttccaacaatggttgaaa
ttgaaagcttacgctaacgacaaccacatcgaaatcgttggggacatgccaatctacgta
gcggaagattcaagtgatatgtgggcaaatccacatctcttcaaaacagatgtcaatggt
aaggctacttgtatcgcaggatgcccaccagatgagttttctgtaactggtcagctttgg
ggtaacccaatctatgactgggaagcaatggacaaagacggctacaaatggtggattgaa
cgcttgcgtgaaagcttcaaaatctacgatatcgttcgtatcgaccacttccgtggcttc
gaatcttactgggaaatccctgctggttccgatacagcagcacctggtgagtgggtgaaa
ggtccaggctacaagctttttgcagccgttaaggaagaacttggtgagctaaacatcatc
gcagaagaccttggcttcatgacagatgaagtgatcgaattgcgtgaacgtactggcttc
ccaggaatgaagattcttcaatttgccttcaacccagaagacgaaagcattgatagccca
cacttggcacctgctaactcagttatgtacacaggaacacacgataacaatacggttctt
ggttggtaccgtaatgagattgatgatgcgactcgtgagtacatggctcgttacacgaac
cgtaaagaatacgaaacagtggtacacgctatgcttcgtacagtattttcatcagttagc
tttatggcaattgcaactatgcaagatttactagaattggatgaggcagctcgtatgaac
ttcccatctacccttggtggaaactggtcttggcgtatgactgaagatcaattgacacca
gctgtcgaggaaggtttgcttgacttgacaacaatttatcgccgaattaatgaaaatttg
gtagatttaaagaaataa

DBGET integrated database retrieval system