KEGG   Sphingobium japonicum: SJA_C1-00990Help
Entry
SJA_C1-00990      CDS       T01201                                 

Gene name
ruvA
Definition
(GenBank) Holliday junction resolvasome DNA-binding subunit
  KO
K03550  holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
sjp  Sphingobium japonicum
Pathway
sjp03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:sjp00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    SJA_C1-00990 (ruvA)
Enzymes [BR:sjp01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     SJA_C1-00990 (ruvA)
DNA repair and recombination proteins [BR:sjp03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     SJA_C1-00990 (ruvA)
    RecFOR pathway proteins
     SJA_C1-00990 (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuvA_N HHH_5 RuvA_C HHH HHH_2 Sirohm_synth_M
Motif
Other DBs
NCBI-ProteinID: BAI94933
NITE: SJA_C1-00990
UniProt: D4YX51
Position
1:101048..101656
Genome map
AA seq 202 aa AA seqDB search
MIAKLKGRLDSTGLDHAIIDVGGVGYLVGASSRTLAALGPVGEAVTVHTEMLVSDDAIRL
VGFARAEERDWFRLLTGVQGVGSRVALAILSALEPVELHRAVAAGDKAMIARANGVGPKL
AQRIANELKDKIGAAPMPAGAVGAGFAALPTGGHSADAISALQNLGFKPAEASIAVAAAE
EELGEDASLDALVRLALRKAAK
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atgatcgcgaaactgaaaggacggctggacagcacgggcctggaccatgccatcatcgat
gtgggcggggtcggctatctggtcggcgcttcttcccgcacgctcgcggcgctggggccg
gtgggcgaagcggtgacggtccacaccgaaatgctggtgtcggacgatgcgatccgcctg
gtcggcttcgcccgggcggaggagcgcgactggttccgcctgctgaccggcgtgcagggc
gtgggttcccgcgtggcgctggccatcctctccgcgctggaaccggtggaactgcaccgc
gccgtggcggccggcgacaaggcgatgatcgcccgcgccaacggcgtgggtcccaagctt
gcccaacgcatcgccaatgaattgaaggacaagatcggcgcggcgcccatgccggccggg
gcggtcggcgccgggtttgcggcgctgcccaccggcggccacagcgccgatgcgatctcg
gccctccagaatctgggcttcaagcctgccgaagccagcatcgccgtcgccgccgccgaa
gaggaactgggcgaagacgcgtcgctggatgcgctggtgcgcctggcgctcaggaaagcg
gcgaaatga

DBGET integrated database retrieval system