KEGG   Sphingobium japonicum: SJA_C1-02460Help
Entry
SJA_C1-02460      CDS       T01201                                 

Gene name
galU
Definition
(GenBank) UTP-glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
sjp  Sphingobium japonicum
Pathway
sjp00040  Pentose and glucuronate interconversions
sjp00052  Galactose metabolism
sjp00500  Starch and sucrose metabolism
sjp00520  Amino sugar and nucleotide sugar metabolism
sjp01100  Metabolic pathways
sjp01130  Biosynthesis of antibiotics
Module
sjp_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:sjp00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    SJA_C1-02460 (galU)
   00052 Galactose metabolism
    SJA_C1-02460 (galU)
   00500 Starch and sucrose metabolism
    SJA_C1-02460 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    SJA_C1-02460 (galU)
Enzymes [BR:sjp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     SJA_C1-02460 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3
Motif
Other DBs
NCBI-ProteinID: BAI95080
NITE: SJA_C1-02460
UniProt: D4YXJ8
Position
1:complement(262509..263408)
Genome map
AA seq 299 aa AA seqDB search
MSYKPIRKAVFPVAGLGTRFLPATKSVPKELLPVVDRPLIQYAVDEAREAGIEQMIFVTG
RGKGAIEDYFDMAYEAEATQRERGKDLSALDGTRLLPGNAVFLRQQEPLGLGHAIWCARD
IVGDEPFAILLPDEFMKGAPGRGCLKQMVEAYDKVGGNLVCALEVPMADTPSYGVIDPGR
RDGALTEVRGLVEKPAPGTAPSNLILPGRYILQPEVMKILETQEKGAGGEIQLTDAMASM
IGAQPFHGVTFDGRRFDCGSKAGYIEANLALALGREDLGEHIRKFALAELGVGGIAAAA
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atgtcctacaaaccgattcgcaaagccgttttccctgtcgcaggtctcggcacgcgcttt
ctgccggcgaccaagtcggtgcccaaggaactgctgccggtggtggaccgtccgctgatc
caatatgcggtcgacgaagcgcgggaggcggggatcgagcagatgatcttcgtcaccggc
cgcggcaagggcgcgatcgaggattatttcgacatggcctatgaggccgaggcgacgcag
cgcgagcggggcaaggatctgtccgcgctggacggcacgcggctgttgccgggcaatgcg
gtgttcctgcgccagcaggagccgctgggcctgggccatgccatatggtgcgcgcgggac
attgtcggcgacgaacccttcgccatcctgctgcccgacgaattcatgaagggcgcgccg
ggccggggatgcctgaagcagatggtcgaggcctatgacaaggtcggcggcaatctggtc
tgcgcgctggaagtgccgatggccgacacgccgagctatggcgtgatcgatccgggccgg
cgcgacggcgctctcaccgaggtgagggggctggtggaaaagcccgcgccgggcacggcg
ccatccaacctgatcctgccgggccgctacatcctccagcccgaagtgatgaagatcctg
gagacgcaggaaaagggcgcgggcggcgagatccagctcaccgacgccatggcgtcgatg
atcggcgcccagcccttccatggcgtgaccttcgacgggcggcgtttcgactgcggatcg
aaggcgggctatatcgaggcgaaccttgccctggcgctgggtcgcgaggatctgggcgag
catatccgcaagttcgcgctggccgaactgggcgtcggcgggatcgccgccgcagcctga

DBGET integrated database retrieval system