KEGG   Sphingobium japonicum: SJA_C1-04780Help
Entry
SJA_C1-04780      CDS       T01201                                 

Definition
putative thymidine phosphorylase (EC:2.4.2.4)
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
sjp  Sphingobium japonicum
Pathway
Pyrimidine metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:sjp00240]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
1:484546..486084
Genome map
AA seq 512 aa AA seqDB search
MKPGIIEDAEVEPVATTLRAHRLGLSAAGGDLIAVMRQDCPVCRSEGLASRAQVALHAGG
REIVVSLLHSSAEAPAPGEIGLSESAWRRLGVSEGDPVEIAHAQPLASLAEVRRRIYGNR
LSEGAFSAIMTDIAERRYSDVHLSAFITACSAVPLDTDETISLTRAMVDVGERLQWSGAV
IVDKHSVGGLPGNRTTPIIVSIMAAEGLIMPKTSSRAITSPAGTADTMEVLAPVDLDVSA
IRKVVEREGGCIAWGGAVNLSPADDVIIGVERVLDIDAVGQMVASVLSKKIAAGATHLVI
DIPVGPTAKVRGTDAADTLERALSSVAQAFGLRTRVMRGPGAEPIGRGIGPALEAQDILA
VLQGQPGAEDLAHRACELAGGLLELADAAPAGEGYARARACLESGGAWAKFQRICEAQGG
MRAPPVARFQQDMIAPYSGRLVSIDNRKLATVAKLAGAPVAKAAGVALQCRLNQMVDAGA
PLCSIHAESPGELDYAAAYAVSDGPIFGIEAL
NT seq 1539 nt NT seq  +upstreamnt  +downstreamnt
gtgaagcccgggatcatcgaggacgccgaagtagagcctgtcgcgacgacgctgcgggca
caccgcctcggcctgtcggctgccggaggtgatctgatcgcggtcatgcgccaagactgt
cccgtctgccgctcggaaggtctcgcgtcgcgcgcgcaggtcgcgctgcacgccggcggg
cgggaaatcgtagtctcgctgctgcacagttccgcggaggctccagcgcccggcgagatc
ggcctgtccgaatccgcatggcggcggctcggcgtcagcgagggcgatccggtcgagatc
gcgcacgcccagcctctcgcctcgctcgccgaagtgcgtcggcgcatctatggcaatcgt
ctcagtgaaggggctttttcagcgatcatgaccgacatcgccgagcgacgctatagcgat
gtccatctctcggcgttcatcacggcatgctcagcggtcccgctcgatacggacgaaacg
atcagcctgaccagggcgatggtcgatgtcggcgagcgattgcagtggtccggagcggtc
atcgtcgacaagcatagcgtcggtggattgccgggcaatcgcaccacgccgatcatcgtc
tcgatcatggccgcggagggcctgatcatgcccaagacatcgtcgcgggcgatcacctcg
ccggccggcacggcggacacgatggaggtgcttgcacctgtcgacctcgacgtttccgcc
atccgcaaggtggtcgagcgcgaaggcggctgcatcgcctggggcggcgccgtcaatctc
agcccggccgacgatgtgatcatcggcgttgaacgagtgctcgatatcgatgccgtaggg
cagatggtcgcctcggtgctgtccaagaaaatcgcggccggtgcgacccatctggtcatc
gatatcccggtcgggccgaccgccaaggtacgcggaaccgatgccgccgatacgctcgag
cgcgcgctgagctcggtcgcccaagccttcgggcttcgcacgcgcgtgatgcgcggcccc
ggcgcggagccgatcggacggggcatcggcccggcgctcgaggcgcaggatatccttgcc
gtactccaggggcagccgggcgccgaggatctcgcccaccgggcctgcgagctggcggga
ggactgcttgagctcgctgacgcggccccggccggcgaaggctatgcgcgtgcgcgggcg
tgtctcgaaagcggcggggcctgggccaagttccaacgtatctgcgaagcgcagggcggc
atgcgggctccaccggtcgcccggtttcagcaggatatgatcgctccctatagcggccgc
ctggtgagtatcgacaatcgcaagctcgcgacggtcgcgaagctcgccggcgcgccggtg
gccaaggccgctggcgtcgcactgcagtgtcggctgaaccagatggtggatgccggggct
cccttgtgtagcattcatgccgagagcccgggcgagctcgactatgcggcggcctatgcc
gtgagcgacgggccgatcttcgggattgaagcgctatga

DBGET integrated database retrieval system