KEGG   Sphingobium japonicum: SJA_C1-05070Help
Entry
SJA_C1-05070      CDS       T01201                                 

Gene name
adh
Definition
Zn-dependent alcohol dehydrogenase (EC:1.1.1.1)
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
sjp  Sphingobium japonicum
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:sjp00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    SJA_C1-05070 (adh)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SJA_C1-05070 (adh)
  Lipid metabolism
   00071 Fatty acid degradation
    SJA_C1-05070 (adh)
  Amino acid metabolism
   00350 Tyrosine metabolism
    SJA_C1-05070 (adh)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    SJA_C1-05070 (adh)
   00626 Naphthalene degradation
    SJA_C1-05070 (adh)
Enzymes [BR:sjp01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     SJA_C1-05070 (adh)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
1:complement(513481..514506)
Genome map
AA seq 341 aa AA seqDB search
MAKTMKAAVVREFGKPLVIEDAPIPTVGPGQVLVKIAATGVCHTDLHAAEGDWPVKPNPP
FIPGHEGVGHVAAVGAGVTHVKEGDRVGVPWLYTACGHCVHCLGGWETLCHEQQNTGYSV
NGSFAEYVLADPNYVGHLPDNVDFLDIAPILCAGVTVYKGLKATEARPGEWVVVSGIGGL
GHMAVQYARAMGLNVAAVDIDDSKLDLATRLGATLTVNARNEDPSAALKKAIGGAHGALV
TAVSPKAFQQALGMVRRGGTVALNGLPPGDFPLSIFDTVLNGITVRGSIVGTRLDLLEAL
AFAGEGKVKATVHADKLENINDVFSRMHHGDIEGRIVLDLA
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atggcgaaaaccatgaaagcggcggtcgtccgcgaattcggcaagcccctggtcatcgag
gacgcgccgatcccgacggtcggccccgggcaggtcctggtcaagattgcggcaaccggc
gtgtgccataccgacctgcacgcggcagaaggggactggccggtcaagcccaacccgccc
ttcattcctggccatgagggcgtcgggcatgtcgccgccgttggtgccggcgtcacccat
gtgaaggaaggcgaccgggtcggtgtgccctggctctacaccgcctgcgggcactgcgtg
cattgcctgggtggctgggagacgctttgccacgaacagcagaacaccggctattcggtc
aatggcagctttgccgaatatgtcctcgccgatcccaactatgttggtcaccttcccgac
aatgtcgacttcctcgacattgcgccgatcctctgcgcgggcgtcaccgtctacaaggga
ttgaaggccaccgaggcccgacccggcgagtgggtggtcgtctccggcattggcgggctc
ggccacatggcggtgcaatatgcccgagccatgggtctcaatgtggccgcggtcgacatc
gacgatagcaagctcgacctcgctacacgccttggcgccacactgacggtcaacgcgcgc
aacgaggacccttcggcagcgctcaagaaagccattggcggcgcgcacggggcgctggtg
accgccgtttcgcccaaggcgttccagcaggcgctcggcatggtccggcgcggcggcacg
gtcgcgctcaacggcctgccgccgggcgacttcccgttgtcgatcttcgacaccgtgctg
aacggcattaccgtgcgcggctcgatcgtcggcacgcggctcgatctgctcgaggcactg
gcgttcgccggcgagggcaaggtcaaggccacggtccatgcagacaagctggagaacatc
aacgacgtcttctcccgcatgcatcatggcgacatcgagggccggatcgtcctcgacctc
gcctga

DBGET integrated database retrieval system