KEGG   Sphingobium japonicum: SJA_C1-05660Help
Entry
SJA_C1-05660      CDS       T01201                                 

Gene name
bdh
Definition
3-hydroxybutyrate dehydrogenase (EC:1.1.1.30)
Orthology
K00019  
3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
sjp  Sphingobium japonicum
Pathway
Synthesis and degradation of ketone bodies
Butanoate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sjp00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    SJA_C1-05660 (bdh)
  Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    SJA_C1-05660 (bdh)
Enzymes [BR:sjp01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.30  3-hydroxybutyrate dehydrogenase
     SJA_C1-05660 (bdh)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
1:complement(576850..577629)
Genome map
AA seq 259 aa AA seqDB search
MMLSGKVAVITGAASGIGNDIALEFVRHGAKVVIADLQLEKAEAAAAVLDPKGEAAMAVA
MDVADERQVEAGVEAVIKRFGCVDILVSNAGIQIVAPLDEFKFSDWKRLLAIHLDGAFLT
TRACLKHMYAQGGGSVIYMGSVHSKEASVLKAPYVTAKHGLIGLAKVVAKEGAAHGVRAN
VICPGFVRTPLVEKQIPEQARELGISEEDVIKKVMLKETVDGEFTTVEDVARTAVFLAGF
PSNALTGQSIVVSHGWFMQ
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atgatgctgtcaggcaaggtcgcggtcattacaggtgcggcaagcggaatcggcaatgac
atcgcgctcgagttcgtgcgccacggggcgaaggtcgtgatcgccgatctccagctcgag
aaggccgaagctgcggcggcggtgctcgatcccaaaggtgaggcagcgatggccgtcgcg
atggatgtcgccgacgagcgccaagtggaagctggcgtcgaggccgtcataaagcgcttt
ggctgcgttgacattctggtttcgaacgcaggaatccagatcgtcgcaccgctggatgag
ttcaaattttcggactggaaacggctgctcgcgatccatctcgacggcgcattcctgacg
acgcgggcgtgcctcaagcacatgtacgcccagggcggcggcagtgtcatttacatgggc
tccgtccattccaaggaagcgtccgtactgaaagcgccctatgtgacggcgaagcatgga
ctcatcgggctggcgaaggtcgttgcgaaggagggcgcggcgcacggtgtccgcgcgaac
gtgatatgccccggctttgtccgcacgcccctagtcgaaaagcagatcccggagcaggca
cgggagctggggatcagcgaggaagacgtgatcaagaaggtgatgctcaaggagactgtg
gatggcgagttcacgaccgtcgaagacgtcgcccgcaccgcggtgttcctcgcggggttc
ccgagcaacgcgctgacgggtcagtccatcgtcgtcagccacggttggttcatgcaataa

DBGET integrated database retrieval system