KEGG   Sphingobium japonicum: SJA_C1-06770Help
Entry
SJA_C1-06770      CDS       T01201                                 

Gene name
thrC
Definition
threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
sjp  Sphingobium japonicum
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:sjp00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    SJA_C1-06770 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SJA_C1-06770 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    SJA_C1-06770 (thrC)
Enzymes [BR:sjp01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     SJA_C1-06770 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
1:679210..680610
Genome map
AA seq 466 aa AA seqDB search
MHYVSTRGSAPALGFEDVTLAGLASDGGLYVPESWPSFSADQIRALSGLSYVETAVRVMA
PFVAGSLNEEELRELCAAAYGRFSHDAVTPLVQLDHRHWLLELFHGPTLAFKDVALQLLG
QLFERFLSRRDDHLTIVGATSGDTGSAAIDAVAGREKIDIFMLHPDGRVSDVQRRQMTTV
LAPNVHNIAIDGSFDDAQALVKAMFNDADFARRFNLSAVNSINWARLMAQVVYYFYAAVR
LGAPDRAIAFSVPTGNFGDVFAGYVAAKMGLPVAKLMVATNVNDILHRALAEGDYSQGQV
VATATPSMDIQVSSNFERLLFDAGGRDGKALAEQMKGFEASKAMRLTNAQRDGASALFTS
ARVDADAMTMAMRWAYDAAGQVIDPHSAIGLAAARSIDLDPAVPVVTLATAHAAKFPTAV
ERATGIRPSLPSRVGDLFAREEAYAKLPGTFEAVTAYVAGRATPRG
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
atgcactatgtgagcaccaggggaagcgcgcccgcgctcgggttcgaggatgtgacgctg
gccgggctggcgtccgatggcggactttacgttccggaaagctggcccagcttctccgcc
gaccagattcgcgcgctttcgggcctgtcctatgtcgaaacggcggtgcgggtcatggcg
cccttcgtcgccggatcgctcaatgaagaggaactgcgcgaattgtgcgccgccgcctat
ggccggttcagccatgatgcggtgacgccgctggtgcagctcgaccatcgccactggctg
ctggaactgttccacgggccgaccctggcgttcaaggatgtggcgctgcaactgctcggc
cagttgttcgaacgcttcctgtcgcggcgggacgatcatctgaccatcgtcggcgcgacg
tccggagacaccgggtcggcggccatcgacgcggtggcggggcgagagaagatcgacatc
ttcatgctgcatcccgacggccgcgtgtccgacgtgcagcgccgccagatgaccaccgtg
ctggcgcccaacgtccataatatcgccatcgacggcagcttcgacgacgcgcaggcgctg
gtgaaggcgatgttcaacgacgccgatttcgcgcgccgcttcaacctgtcggcggtgaac
agcatcaactgggcgcggctgatggcgcaggtcgtctattatttctacgccgccgtgcgc
ctgggcgcgccggaccgggccatcgccttttccgtccccaccggcaatttcggcgacgtg
ttcgcaggctatgtcgcggcgaagatgggcctgcccgtcgcgaagctgatggtcgcgacc
aacgtcaacgacatcctccaccgcgccttggcggagggcgactatagccagggccaggtg
gtggcgaccgcgacccccagcatggacatccaggtcagttcgaacttcgaacggctgctg
ttcgacgcgggcggccgcgacggcaaggcgctcgccgaacagatgaagggctttgaagcc
agcaaggcgatgcgcctcaccaacgcccagcgggatggcgcgtccgcgctgttcacctcg
gcgcgggtcgatgccgacgccatgaccatggcgatgcgctgggcctatgacgcggcgggg
caggtgatcgatccgcacagcgccatcggcctggcggcggcgcgctcgatcgacctcgat
ccggcggtgcccgtggtcacgctggcgacggcgcatgcggcgaaattccccacggcggtc
gagcgggctaccggcatccgcccgtctctgccttcgcgggtgggcgacctgtttgcgcgg
gaagaggcctatgccaagctgccgggcaccttcgaagcggtcaccgcctatgtcgcgggg
cgggcgacgccgaggggctga

DBGET integrated database retrieval system