KEGG   Sphingobium japonicum: SJA_C1-07240Help
Entry
SJA_C1-07240      CDS       T01201                                 

Gene name
glpK
Definition
glycerol kinase (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
sjp  Sphingobium japonicum
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:sjp00561]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
1:740967..742433
Genome map
AA seq 488 aa AA seqDB search
MSERPILVLDEGTTSTRAMLYAPDGRRLGMAQADLGQYYPRPGWVEHDATEIWEKTLACA
RDMVALAGGADQVAAIGITNQRETVVAWDRRTGEPLAPAIVWQDRRTAGHCAALREAGEE
EAVQRRTGLVLDPYFSATKMRWLLDHAPAVAEAGARLAFGTIESWLMWKLTGGQHVSDAS
NASRTQLMALDGTDWDIGLCDLFGVPPQALPEIVDNIGAFGATQAEWFGQPIAIRGLMGD
QQAATIGQACLTPGDAKATLGTGAFVLAYMGGAVPVSRHRLLGTLLCRLPGETSYALEGS
LFVAGSLVQWMRDELRLIATAEESEALARSVPDSGGVAMLPALAGLGAPHWRADAKGTIH
GLTLGTKRAHIVRAALESLSHQLHDLAGAFAADGMPWRTLCIDGGMSANDWIAQDLADIL
DLPVDRPADVETTARGAAMLAAVGAGLFPSLAAAAAAMRAERRCFTPALPDDARNERLRR
WHALLACA
NT seq 1467 nt NT seq  +upstreamnt  +downstreamnt
atgagcgagcggccgatattggtgctggacgagggcacgacatccacccgggcgatgctc
tacgccccggacgggcggcggcttggcatggcgcaggcggaccttggccaatattatccc
cggcccggctgggtcgagcatgatgcgacggagatctgggaaaagaccctggcctgcgcg
cgcgacatggtggcgctggcgggcggggcggatcaggtcgccgccatcggcatcaccaac
cagcgcgaaaccgtggtcgcgtgggaccggcggacaggcgagccgctggcccccgccatc
gtctggcaggaccgccgcaccgccggtcattgcgccgccctgcgcgaggcgggggaggag
gaggcggtccagcggcggacgggactggtgctcgacccctatttctccgcgacgaagatg
cgctggcttttggaccatgcgcccgccgtggcggaggcgggagccaggctcgccttcggc
accatcgaaagctggctgatgtggaagctgaccggcggacagcatgtcagcgacgccagc
aatgccagccgaacccagttgatggcgctggacggcacggattgggacatcggcctgtgc
gacctgttcggcgtgccgccgcaggccctgccggagatcgtcgacaatatcggcgccttt
ggcgcgacgcaggccgaatggttcggccagccgatcgcgatccggggactgatgggggat
cagcaggcggcgaccatcggccaggcctgcctgacgccgggcgacgccaaggcgacattg
ggcaccggggccttcgtccttgcctatatgggcggggccgtgccggtgtcgcggcatcgg
ctgctcggcaccctgctttgccgcctgccgggcgagacgagctatgcgctggaaggatcg
ctgttcgtcgcgggcagcctggtccagtggatgcgcgacgaactgcgcctgatcgccacg
gcggaggaaagcgaagcgctggcccgttcggtgcccgacagcggcggcgtcgccatgctg
cccgcattggcggggttgggcgcgccgcactggcgcgccgacgccaaggggacgatccat
gggctgacgctgggcacgaagcgggcgcatatcgtgcgcgcggcgctcgaatcgctctcc
caccagcttcacgacctggccggcgcgttcgcggccgacggcatgccctggcggaccctg
tgcatcgacggcgggatgagcgccaacgactggatcgcgcaggatctggccgacattctg
gacctgcccgtggatcgccccgccgatgtggagaccaccgccaggggcgcggcgatgctg
gcggcggtgggcgcgggcctgtttccctccctcgccgcggcagccgcggcgatgcgggcg
gaacggcgatgcttcacgccggccttgccggacgatgccaggaacgaaaggctgcggcgt
tggcatgcgctgctggcctgtgcgtga

DBGET integrated database retrieval system