KEGG   Sphingobium japonicum: SJA_C1-08400Help
Entry
SJA_C1-08400      CDS       T01201                                 

Gene name
trpC
Definition
indole-3-glycerol phosphate synthase (EC:4.1.1.48)
Orthology
K01609  
indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
sjp  Sphingobium japonicum
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:sjp00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    SJA_C1-08400 (trpC)
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SJA_C1-08400 (trpC)
Enzymes [BR:sjp01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     SJA_C1-08400 (trpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
1:851752..852543
Genome map
AA seq 263 aa AA seqDB search
MTNKLIEICDVKRDEVARRKAATPISSLHARAAAQTPPRGFRKALDDAARSGFGLIAEVK
KASPSKGLIRPDFDPPAHARAYAAGGAACLSVLTDEPYFQGHDDYLVAARSACALPVLRK
DFMVDPWQVLESRSLGADAILIIVAALDDNQMAEIEDAALGLGMDALVEVHDAQELERAM
KLRSRLIGVNNRDLRDFTVDFARTYELVGQAPEGCTFVAESGIGGHDDLIAMSDHGVRCF
LVGETLMRQADVEAATRKLLTGR
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atgaccaacaagctgatcgaaatctgcgacgtgaagcgggatgaggtcgcccggcgcaag
gccgccacgcccatatcctcgctccacgcccgcgccgccgcacagacgccgccgcggggc
ttccgcaaggcgctggacgatgccgcccgctccggcttcggcctgatcgcggaggtcaag
aaggccagcccgtccaagggcctgatccgccccgatttcgatccgcccgcccatgcccgc
gcctatgcggcggggggcgcggcctgcctgtcggtgctgaccgacgaaccctatttccag
gggcatgacgattatctggtcgccgcccggtccgcctgcgccctgccggtgctgcgcaag
gatttcatggtcgatccctggcaggtgctggaaagccgctcgctcggcgccgacgcgatc
ctgatcatcgtcgccgcgctggacgacaaccagatggcggagatagaggacgccgccctt
ggcctgggcatggatgcgctggtcgaagtgcatgacgcgcaggaactggagcgggcgatg
aagctgcgttcccgcctgatcggcgtcaacaatcgcgacctgcgcgatttcaccgtcgat
ttcgcccgcacctatgaactggtggggcaggcgccggagggctgcaccttcgtcgcggaa
agcggcatcggcggccatgacgacctgatcgctatgtctgaccatggcgtgcgctgcttc
ctggtcggggaaacgctgatgaggcaggcggacgtcgaagccgccacgcgcaagctgctc
acgggccgatga

DBGET integrated database retrieval system