KEGG   Sphingobium japonicum: SJA_C1-10460Help
Entry
SJA_C1-10460      CDS       T01201                                 

Gene name
cheB
Definition
(GenBank) two-component system response regulator CheB
  KO
K03412  two-component system, chemotaxis family, protein-glutamate methylesterase/glutaminase [EC:3.1.1.61 3.5.1.44]
Organism
sjp  Sphingobium japonicum
Pathway
sjp02020  Two-component system
sjp02030  Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:sjp00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    SJA_C1-10460 (cheB)
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    SJA_C1-10460 (cheB)
Enzymes [BR:sjp01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     SJA_C1-10460 (cheB)
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.44  protein-glutamine glutaminase
     SJA_C1-10460 (cheB)
Two-component system [BR:sjp02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   SJA_C1-10460 (cheB)
Bacterial motility proteins [BR:sjp02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    SJA_C1-10460 (cheB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CheB_methylest Response_reg
Motif
Other DBs
NCBI-ProteinID: BAI95880
NITE: SJA_C1-10460
UniProt: D4YZU8
Position
1:1053845..1054921
Genome map
AA seq 358 aa AA seqDB search
MTVHVPIMASRDEDRALRTLIVDDSVVVRTVIERILNADRRFSVTHKTNSAEHALGYLQD
HEVDLILLDIELPGQSGLMALPAILGINPRAKVVILSGNCEEGSAAAVEALALGASDILA
KPGSGSFGEHFPQALIDRLLRLFSGAATPVTVRPPLRIDPEQAAQPLACLGIGASTGGIH
ALGQLFAGLAAPLGVPILLTQHLPASFTHYFVQQLGRMTFLRVKVAEQGEMLAPDIVYVA
PGDANLQLRPGLYGRVSVALNPQRTPTGNLPGVDPMFASMAQAYGAGAAGVVLTGMGRDG
TAGARDIVAAGGWIVAQDEASSVVWGMPGSIAGEGLNCALLEPHAIMDFVARRGKNRN
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
atgaccgttcacgtgccgatcatggccagcagggacgaggacagggcgctgcgcaccctg
atcgtcgacgattcggtcgtggtcaggacggtcatagagcggattttgaacgccgaccgg
cgattttccgtcacgcacaagaccaacagcgccgaacatgcgctgggctatttgcaggac
catgaggtcgacctgatcctgctcgacatagagttgccggggcagagcggcctcatggcg
ctgccggctattctggggatcaacccccgcgccaaggtcgtgatcctgtcgggcaattgc
gaggaggggagcgccgcggcggtcgaggcgctggcgctgggcgcgagcgacatattggcc
aagccgggaagcggcagcttcggcgagcatttcccccaggccctgatcgaccgcctgttg
cgcctgttcagcggcgctgcgaccccggtcacggtccggccgccgctgcggatcgatccg
gaacaggcggcccagccgcttgcctgcctgggcatcggcgcatcgaccggcggcatccat
gccctgggacagctttttgcggggctggccgcgccgctgggcgtgccgatcctgctgacc
cagcatctgcccgccagcttcacccattatttcgtccagcaactggggcgcatgacgttc
ctgcgcgtcaaggtggcggaacagggagagatgctggccccggacatcgtctatgtcgcg
ccgggcgacgccaatctccagcttcggccgggcctttacggccgggtgtcggtggcgctc
aatccgcagcgcacgccgaccggcaacctgcccggcgtcgacccgatgttcgccagcatg
gcccaggcctatggcgccggcgcggcgggcgtggtgctgaccggcatggggcgggacggg
acggcgggcgcgcgcgacatcgtggcggcgggcggctggatcgtggcgcaggacgaagcg
agcagcgtggtctggggcatgcccggatcgatcgccggagaaggattgaactgcgccctg
ctggaaccccatgcgatcatggacttcgtggcgcgaagaggaaagaacaggaactga

DBGET integrated database retrieval system