KEGG   Sphingobium japonicum: SJA_C1-10720Help
Entry
SJA_C1-10720      CDS       T01201                                 

Gene name
sdhD
Definition
succinate dehydrogenase hydrophobic anchor subunit (EC:1.3.5.1)
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
sjp  Sphingobium japonicum
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:sjp00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SJA_C1-10720 (sdhD)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SJA_C1-10720 (sdhD)
   00650 Butanoate metabolism
    SJA_C1-10720 (sdhD)
  Energy metabolism
   00190 Oxidative phosphorylation
    SJA_C1-10720 (sdhD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
1:1077684..1078073
Genome map
AA seq 129 aa AA seqDB search
MGTGTGIGRVRGLGSARHGAHHWLAQRYTAIGNLLLVLWLLFSLIALPGLDYQSVVGWIA
NPLVAVPLMLMIVSIFWHLRLGMQVMLEDYVHDKGLAFLSMLLLNFYAFGGAAAGVFAIA
KIAFTGIVK
NT seq 390 nt NT seq  +upstreamnt  +downstreamnt
atgggaaccggaactggaatcggccgcgtccgcggtcttggatcggccaggcacggcgcg
catcactggctggcgcagcgctataccgccatcggcaacctgctgctggtgctgtggctg
ctgttcagcctgattgccctgccgggcctcgattatcagagcgtcgtgggctggatcgcc
aatccgctggtggcggtgccgctgatgctgatgatcgtcagcatcttctggcacctgcgc
ctggggatgcaggtgatgctggaggattatgtccatgacaaggggctggccttcctctcc
atgctgttgctgaacttctatgcctttggcggcgcggccgcgggcgtcttcgcgatcgcc
aagatcgccttcacggggatcgtcaaataa

DBGET integrated database retrieval system