KEGG   Sphingobium japonicum: SJA_C1-10720Help
Entry
SJA_C1-10720      CDS       T01201                                 

Gene name
sdhD
Definition
(GenBank) succinate dehydrogenase hydrophobic anchor subunit
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
sjp  Sphingobium japonicum
Pathway
sjp00020  Citrate cycle (TCA cycle)
sjp00190  Oxidative phosphorylation
sjp00650  Butanoate metabolism
sjp01100  Metabolic pathways
sjp01110  Biosynthesis of secondary metabolites
sjp01120  Microbial metabolism in diverse environments
sjp01130  Biosynthesis of antibiotics
sjp01200  Carbon metabolism
Module
sjp_M00009  Citrate cycle (TCA cycle, Krebs cycle)
sjp_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
sjp_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:sjp00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SJA_C1-10720 (sdhD)
   00650 Butanoate metabolism
    SJA_C1-10720 (sdhD)
  Energy metabolism
   00190 Oxidative phosphorylation
    SJA_C1-10720 (sdhD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt CybS
Motif
Other DBs
NCBI-ProteinID: BAI95906
NITE: SJA_C1-10720
UniProt: D4YZX4
Position
1:1077684..1078073
Genome map
AA seq 129 aa AA seqDB search
MGTGTGIGRVRGLGSARHGAHHWLAQRYTAIGNLLLVLWLLFSLIALPGLDYQSVVGWIA
NPLVAVPLMLMIVSIFWHLRLGMQVMLEDYVHDKGLAFLSMLLLNFYAFGGAAAGVFAIA
KIAFTGIVK
NT seq 390 nt NT seq  +upstreamnt  +downstreamnt
atgggaaccggaactggaatcggccgcgtccgcggtcttggatcggccaggcacggcgcg
catcactggctggcgcagcgctataccgccatcggcaacctgctgctggtgctgtggctg
ctgttcagcctgattgccctgccgggcctcgattatcagagcgtcgtgggctggatcgcc
aatccgctggtggcggtgccgctgatgctgatgatcgtcagcatcttctggcacctgcgc
ctggggatgcaggtgatgctggaggattatgtccatgacaaggggctggccttcctctcc
atgctgttgctgaacttctatgcctttggcggcgcggccgcgggcgtcttcgcgatcgcc
aagatcgccttcacggggatcgtcaaataa

DBGET integrated database retrieval system