KEGG   Sphingobium japonicum: SJA_C1-11360Help
Entry
SJA_C1-11360      CDS       T01201                                 

Gene name
cyc
Definition
cytochrome c
Orthology
K08738  
cytochrome c
Organism
sjp  Sphingobium japonicum
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Brite
KEGG Orthology (KO) [BR:sjp00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    SJA_C1-11360 (cyc)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    SJA_C1-11360 (cyc)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
1:complement(1130587..1131258)
Genome map
AA seq 223 aa AA seqDB search
MGRMRGLAVGLCVAGAAATLLGAGWFSDRLYTRERPGQLAYRMDDMPPRVDMAAIQRDWP
ASFSEPGEGSRVIAYHRDMRGKAPAPGTDGGGGAVAPPPDLGALLASADAGAGKRKAQQC
MSCHDLGQGGPNGIGPNLWGVVGRAMASHAGFAYSPAMRAQEGDWSYERLFAFLASPGRD
MPGTKMSFAGLRKPEDRAAVIKYLATLGTGAPPLPQPKAVASR
NT seq 672 nt NT seq  +upstreamnt  +downstreamnt
atgggccggatgcgcggattggcggtggggctgtgcgtcgccggggcggccgcgacgctg
ctgggcgcggggtggttcagcgaccggctctacacgcgggaaaggccgggacagcttgcc
tacaggatggacgacatgccgccgcgcgtcgacatggcggccatccagcgcgattggccc
gccagcttcagcgaaccgggggaaggcagccgcgtcatcgcctatcatcgcgacatgcgg
ggcaaggcgccggcgcccgggacggacggcggcggcggcgcggtcgctccaccccctgac
ctcggcgccctgcttgccagtgcggacgccggtgcggggaagcggaaggcgcagcaatgc
atgagctgccatgaccttggccaaggcggccccaacgggatcgggccgaatctgtggggc
gtggtcggcagagcgatggccagccatgcgggcttcgcctattcccccgccatgcgggcg
caagagggcgattggagctatgaaagactcttcgccttcctcgcctcgccggggcgggac
atgccggggacgaagatgagcttcgccggactgcgcaagccggaggatcgggccgcggtg
atcaaatatctggcgaccctggggacgggagcaccgcccttgccccagcccaaggcggtt
gcttcgcggtaa

DBGET integrated database retrieval system