KEGG   Sphingobium japonicum: SJA_C1-11590Help
Entry
SJA_C1-11590      CDS       T01201                                 

Gene name
sucC
Definition
(GenBank) succinyl-CoA synthetase beta chain
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
sjp  Sphingobium japonicum
Pathway
sjp00020  Citrate cycle (TCA cycle)
sjp00640  Propanoate metabolism
sjp00660  C5-Branched dibasic acid metabolism
sjp01100  Metabolic pathways
sjp01110  Biosynthesis of secondary metabolites
sjp01120  Microbial metabolism in diverse environments
sjp01130  Biosynthesis of antibiotics
sjp01200  Carbon metabolism
Module
sjp_M00009  Citrate cycle (TCA cycle, Krebs cycle)
sjp_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:sjp00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SJA_C1-11590 (sucC)
   00640 Propanoate metabolism
    SJA_C1-11590 (sucC)
   00660 C5-Branched dibasic acid metabolism
    SJA_C1-11590 (sucC)
Enzymes [BR:sjp01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     SJA_C1-11590 (sucC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5
Motif
Other DBs
NCBI-ProteinID: BAI95993
NITE: SJA_C1-11590
UniProt: D4Z061
Position
1:1153378..1154577
Genome map
AA seq 399 aa AA seqDB search
MNIHEYQAKELLAKYGAPIAAGYAAFSVEEAVEAAKKLPGPLYVVKSQIHAGGRGKGKFK
ELGPDAKGGVRLAFNLDEVKAHAADMLGNTLVTIQTGEAGKQVNRLYVTDGADIAKEFYL
ALLVDRATGRVAFVVSTEGGMDIEEVAHSTPEKIHTFAVDPATGFMPHHGRAVAAALELT
GDQAKQAAKVASSLYEAFLATDASQIEINPLAVTQQGNLLVLDAKVGFDGNALFRHKDIV
ELRDLTEEDAAEVEASEYDLAYIKLDGNIGCMVNGAGLAMATMDIIKLNGEFPANFLDVG
GGASKEKVTAAFKIILKDPAVKGILVNIFGGIMKCDIIADGIVAAAKDVNLSVPLVVRLE
GTNVQQGKDILAASGLAIVPADDLGDAARKIVAEVRKAA
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atgaacatccacgaatatcaggcgaaggagctgctggcgaaatatggcgcgccgatcgcc
gccggctatgcagccttctccgtcgaggaagccgtcgaggctgccaagaagctgcctggg
ccgctctatgtcgtgaagtcgcagatccacgccggcggccgcggcaagggcaagttcaag
gaactcggtcccgatgcgaaggggggcgtccgcctggccttcaacctggacgaggtgaag
gcccacgccgccgacatgctgggcaacacgctggtcaccatccagaccggcgaagcgggc
aagcaggtcaaccgcctctacgtcaccgacggcgccgacatcgccaaggaattctacctg
gctctgctggtcgaccgcgccaccggccgcgtggccttcgtcgtgtcgaccgagggcggc
atggacatcgaggaagtcgcccactcgacccctgagaagatccataccttcgccgtcgat
ccggccaccggcttcatgccgcaccatggccgcgccgtcgccgccgcgctggaactgacc
ggcgatcaggcgaagcaggccgccaaggtcgcatcctcgctctatgaagccttcctggcg
accgacgcctcgcagatcgaaatcaacccgctggccgtcacccagcagggcaacctgctc
gtcctcgacgccaaggtcggcttcgacggcaacgcgctgttccgtcacaaggacatcgtc
gagctgcgcgacctgaccgaggaagacgcggctgaggtcgaggcttcggaatatgacctc
gcctacatcaagctggacggcaatatcggctgcatggtgaacggcgccggcctggccatg
gcgaccatggacatcatcaagctgaacggcgaattccccgccaacttcctggacgtcggc
ggcggcgcttccaaggagaaggtgaccgcagccttcaagatcatcctaaaggatccggcg
gtgaagggcattctcgtcaatatcttcggcggcatcatgaagtgcgacatcattgccgac
ggcatcgtcgccgccgccaaggacgtgaacctgtcggttccgctggtcgtccgcctggaa
ggcacgaacgtccagcagggcaaggacattctcgcggcttcgggcctggccatcgtcccg
gcggacgatctgggcgacgcggccaggaagatcgtggcggaagtgaggaaggcggcctga

DBGET integrated database retrieval system