KEGG   Sphingobium japonicum: SJA_C1-11900Help
Entry
SJA_C1-11900      CDS       T01201                                 

Gene name
mhpF
Definition
acetaldehyde dehydrogenase (acylating) (EC:1.2.1.10)
Orthology
K18366  
acetaldehyde/propanal dehydrogenase [EC:1.2.1.10 1.2.1.87]
Organism
sjp  Sphingobium japonicum
Pathway
Benzoate degradation
Pyruvate metabolism
Dioxin degradation
Xylene degradation
Butanoate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Module
Catechol meta-cleavage, catechol => acetyl-CoA / 4-methylcatechol => propanoyl-CoA
Brite
KEGG Orthology (KO) [BR:sjp00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    SJA_C1-11900 (mhpF)
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    SJA_C1-11900 (mhpF)
   00650 Butanoate metabolism
    SJA_C1-11900 (mhpF)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    SJA_C1-11900 (mhpF)
   00622 Xylene degradation
    SJA_C1-11900 (mhpF)
   00621 Dioxin degradation
    SJA_C1-11900 (mhpF)
Enzymes [BR:sjp01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     SJA_C1-11900 (mhpF)
    1.2.1.87  propanal dehydrogenase (CoA-propanoylating)
     SJA_C1-11900 (mhpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
1:1181564..1182454
Genome map
AA seq 296 aa AA seqDB search
MTKVKCAIIGPGNIGTDLLYKLLRSDRLEPVWMVGVDPTSEGLARARELGLKTTDAGVDG
LVPHVARDGVKIAFDATSAYVHAENSRKLNELGVLMIDLTPAAIGPLCVPAVNLARQARD
GAVNVNMVTCAGQATIPMVNAVSRVQPVDYAEIIATVASRSIGPGTRKNIDEFTRTTSAA
IEKVGGAAKGKAIVVVNPAEPPLMMRDTVYCETADEPDREAISASVHEMIAQVQRYVPGY
RLKNGPTFEGRKVSIFLEVEGLGDFLPRYAGNLDIMTAAAARTGEMFAQEMMESVQ
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
atgaccaaagtgaaatgcgccatcatcgggccgggcaatatcggcaccgacctgctctac
aagctgctgcgttccgacaggctggagccggtctggatggtgggcgtcgatccgacgtcc
gaggggctggcgcgggcgcgggagctggggctgaagaccaccgacgcgggcgtcgatggc
ctggtgccgcatgtcgccagggacggcgtgaagatcgcgttcgacgcgacgtcggcctat
gtccatgccgaaaacagccgcaagctgaacgagctgggcgtgctgatgatcgacctgacg
ccggcggccatcggtccgctttgcgtgccggcggtcaacctggcgcggcaggcgcgcgac
ggcgcggtcaacgtcaacatggtgacctgcgcgggtcaggcgacgatcccgatggtgaac
gcggtcagccgcgtccagccggtcgactatgccgagatcatagcgaccgtggcgtccagg
tcgatcggccccggcacgcgcaagaatatcgacgagttcacccgcaccacctccgccgcg
atcgagaaggtcggcggcgcggcgaagggcaaggcgatcgtcgtcgtcaatcccgccgaa
ccgccgctgatgatgcgcgacaccgtctattgcgagaccgccgacgagccggaccgcgag
gcgatcagcgcatccgtgcacgagatgatcgcgcaggtgcagcgctatgtgccgggctat
cggctgaagaacggcccgaccttcgaggggcgcaaggtctccatcttcctggaggtcgag
gggctgggcgacttcctgccccgatatgcgggcaatctggacatcatgaccgccgccgcg
gcgcgcacgggcgagatgttcgcgcaggagatgatggagagcgtgcaatga

DBGET integrated database retrieval system