KEGG   Sphingobium japonicum: SJA_C1-15940Help
Entry
SJA_C1-15940      CDS       T01201                                 

Gene name
cyc
Definition
(GenBank) cytochrome c
  KO
K08738  cytochrome c
Organism
sjp  Sphingobium japonicum
Pathway
sjp02020  Two-component system
Brite
KEGG Orthology (KO) [BR:sjp00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    SJA_C1-15940 (cyc)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cytochrom_C Cytochrome_CBB3
Motif
Other DBs
NCBI-ProteinID: BAI96428
NITE: SJA_C1-15940
UniProt: D4Z1E6
Position
1:complement(1582359..1582733)
Genome map
AA seq 124 aa AA seqDB search
MISRFAALAAAMLIASPALAQTGDAAKGKAVFARCMACHAVDPGVNRLGPSLGGIVGRPS
GAAPGFAYSAAMKKASIRWDAKSLDAFLTKPSASVPGNKMMFAGLPNPADRANLIAYLAS
AGRK
NT seq 375 nt NT seq  +upstreamnt  +downstreamnt
atgatttcgaggttcgccgcgctcgccgctgccatgctgatcgcgagtcccgcgcttgcc
cagactggcgacgccgccaagggcaaggcggtcttcgcccgctgcatggcctgtcatgcg
gtcgatccgggagtcaaccgtctgggtccgtcgctcggaggaatcgtgggccggccatcc
ggcgcggctccgggtttcgcctattccgccgcgatgaagaaagccagtatccgctgggac
gccaagtcgctggacgctttcctgaccaagccttccgccagcgtgccgggcaacaagatg
atgttcgcgggcctgcccaatcccgcggatcgcgccaatctgatcgcctatctcgccagc
gcgggcaggaaatga

DBGET integrated database retrieval system