KEGG   Sphingobium japonicum: SJA_C1-16120Help
Entry
SJA_C1-16120      CDS       T01201                                 

Gene name
tpiA
Definition
(GenBank) triosephosphate isomerase (TIM)
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
sjp  Sphingobium japonicum
Pathway
sjp00010  Glycolysis / Gluconeogenesis
sjp00051  Fructose and mannose metabolism
sjp00562  Inositol phosphate metabolism
sjp01100  Metabolic pathways
sjp01110  Biosynthesis of secondary metabolites
sjp01120  Microbial metabolism in diverse environments
sjp01130  Biosynthesis of antibiotics
sjp01200  Carbon metabolism
sjp01230  Biosynthesis of amino acids
Module
sjp_M00002  Glycolysis, core module involving three-carbon compounds
sjp_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:sjp00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SJA_C1-16120 (tpiA)
   00051 Fructose and mannose metabolism
    SJA_C1-16120 (tpiA)
   00562 Inositol phosphate metabolism
    SJA_C1-16120 (tpiA)
Enzymes [BR:sjp01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     SJA_C1-16120 (tpiA)
Exosome [BR:sjp04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   SJA_C1-16120 (tpiA)
  Exosomal proteins of bladder cancer cells
   SJA_C1-16120 (tpiA)
  Exosomal proteins of melanoma cells
   SJA_C1-16120 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: BAI96446
NITE: SJA_C1-16120
UniProt: D4Z1G4
Position
1:1600926..1601666
Genome map
AA seq 246 aa AA seqDB search
MSRRKLVVGNWKMNGLRAQLGEVEAIGGLARDYPAAEVGLCLPATLISAADGMKGAAFIG
AQDCHMKESGAHTGCLSAAMLAEAGASWTIVGHSERRQDQGETDADIAAKALAAKAAGLK
VILCVGESLDVRDAGDAEAVVSAQLIASLPEGAASDWLAIAYEPIWAIGTGRIPTMEAVA
AMHAALRAALASRIGPDADEMRILYGGSMNGDNAAELLALADVDGGLIGGASLTAAKFAP
VIAAAA
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgagcaggcggaagctggttgtcggcaactggaagatgaacggcctgcgcgcccaattg
ggcgaggtggaggccattggcgggctggcgcgcgactatccggcggcggaagtcgggctg
tgcctgcccgcgacgctgatttcggcggcggacggcatgaagggcgcggccttcatcggc
gcgcaggactgccatatgaaggaaagcggcgcgcataccggctgcctctccgccgccatg
ctggccgaagccggggcaagctggaccatcgtcggccatagcgagcggcggcaggaccag
ggcgaaaccgacgcggacatcgcggcgaaggcgctggcggccaaggctgcggggctgaag
gtcatcctctgcgtgggcgaaagcctggacgtgcgcgacgcgggggatgcggaggcggtg
gtttcggcgcaactgatcgcctccttgccggaaggcgcggcgtccgactggctggccatc
gcctatgaaccgatctgggccatcggcacgggccggatccccacaatggaagcggtcgcc
gcgatgcacgccgccctgcgcgccgcgctggcgagccggatcggcccggatgccgacgag
atgcgaatcctctatggcggatcgatgaacggcgacaatgcggcggagcttctggcgctg
gccgatgtcgacggcggcctgatcggcggcgcgagcctgacggcggcgaaattcgccccg
gtgatcgcggcggcggcctga

DBGET integrated database retrieval system