KEGG   Sphingobium japonicum: SJA_C1-16120Help
Entry
SJA_C1-16120      CDS       T01201                                 

Gene name
tpiA
Definition
triosephosphate isomerase (TIM) (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
sjp  Sphingobium japonicum
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:sjp00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SJA_C1-16120 (tpiA)
   01230 Biosynthesis of amino acids
    SJA_C1-16120 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SJA_C1-16120 (tpiA)
   00051 Fructose and mannose metabolism
    SJA_C1-16120 (tpiA)
   00562 Inositol phosphate metabolism
    SJA_C1-16120 (tpiA)
Enzymes [BR:sjp01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     SJA_C1-16120 (tpiA)
Exosome [BR:sjp04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   SJA_C1-16120 (tpiA)
  Exosomal proteins of bladder cancer cells
   SJA_C1-16120 (tpiA)
  Exosomal proteins of melanoma cells
   SJA_C1-16120 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
1:1600926..1601666
Genome map
AA seq 246 aa AA seqDB search
MSRRKLVVGNWKMNGLRAQLGEVEAIGGLARDYPAAEVGLCLPATLISAADGMKGAAFIG
AQDCHMKESGAHTGCLSAAMLAEAGASWTIVGHSERRQDQGETDADIAAKALAAKAAGLK
VILCVGESLDVRDAGDAEAVVSAQLIASLPEGAASDWLAIAYEPIWAIGTGRIPTMEAVA
AMHAALRAALASRIGPDADEMRILYGGSMNGDNAAELLALADVDGGLIGGASLTAAKFAP
VIAAAA
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgagcaggcggaagctggttgtcggcaactggaagatgaacggcctgcgcgcccaattg
ggcgaggtggaggccattggcgggctggcgcgcgactatccggcggcggaagtcgggctg
tgcctgcccgcgacgctgatttcggcggcggacggcatgaagggcgcggccttcatcggc
gcgcaggactgccatatgaaggaaagcggcgcgcataccggctgcctctccgccgccatg
ctggccgaagccggggcaagctggaccatcgtcggccatagcgagcggcggcaggaccag
ggcgaaaccgacgcggacatcgcggcgaaggcgctggcggccaaggctgcggggctgaag
gtcatcctctgcgtgggcgaaagcctggacgtgcgcgacgcgggggatgcggaggcggtg
gtttcggcgcaactgatcgcctccttgccggaaggcgcggcgtccgactggctggccatc
gcctatgaaccgatctgggccatcggcacgggccggatccccacaatggaagcggtcgcc
gcgatgcacgccgccctgcgcgccgcgctggcgagccggatcggcccggatgccgacgag
atgcgaatcctctatggcggatcgatgaacggcgacaatgcggcggagcttctggcgctg
gccgatgtcgacggcggcctgatcggcggcgcgagcctgacggcggcgaaattcgccccg
gtgatcgcggcggcggcctga

DBGET integrated database retrieval system