KEGG   Sphingobium japonicum: SJA_C1-19290Help
Entry
SJA_C1-19290      CDS       T01201                                 

Definition
beta-1,4-xylanase (EC:3.2.1.8)
Orthology
K01181  
endo-1,4-beta-xylanase [EC:3.2.1.8]
Organism
sjp  Sphingobium japonicum
Brite
Enzymes [BR:sjp01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.8  endo-1,4-beta-xylanase
     SJA_C1-19290
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
1:1935541..1936668
Genome map
AA seq 375 aa AA seqDB search
MRRREFLAGAAALSACSPIQPSAAQVGGTAGLAAHARKSGRYFGAAIKSRQLREDPDFTA
AVAHECDMVVQEYELKRGTTEPKPGRYDFSGADQIIAFAQRHGMRARGHALVWYAAQPPW
LEPALKAAGRAERETLMTSYIDTAMRRYAGKIREWDVVNEAIEPNDGRADGMRAKSMWMD
ALGEDYVDIAFHRAREVDPRPMRFLTDFGIEHDSPRCERRRTAMLKLLDRLMARNVPVDA
IGIQGHLKPYREGFNQARFARFLDQLSGYGLALSITEFDVADRGGPPNPEKRDKEIASVA
KAFLDVALDNPAMRSVLCWGLSDRYSWLSNFKDYKWPDGQLSRGLPLDGGMRRKPLWDAI
AAAFDAAPAMRSAGA
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
gtgagacggcgcgaattcctggcgggcgcggcggcgctttccgcatgctcccccatccag
ccgagcgccgcgcaggtcggcggcacggcgggccttgccgcccatgcccgcaagtctggc
cgctatttcggcgccgcgatcaagtcgcgccagttgcgcgaagaccccgatttcacggcc
gccgtcgcccacgaatgcgacatggtcgtccaggaatatgaactgaagcgcggcacgacc
gagccgaagcccggccgatatgatttcagcggcgcggaccagatcatcgccttcgcgcag
cggcacggcatgcgcgcaaggggccatgcgctggtatggtatgccgcgcagccgccctgg
ctggagccggcgctgaaggccgccggccgtgccgaacgcgaaacgctgatgaccagctat
atcgacaccgccatgcgccgttacgcgggcaaaatccgcgaatgggacgtcgtcaacgaa
gccatcgagccgaatgacggccgcgccgacggcatgcgcgccaagagcatgtggatggac
gcgctgggagaggattatgtcgacatcgccttccaccgcgcgcgggaggtcgacccccgg
cccatgcggttcctgaccgatttcgggatagagcacgactccccccgctgcgagcgtcgc
cgcaccgccatgctgaagctgctcgaccggctgatggcgcgcaacgtgccggtggacgcc
atcggcatacaggggcatttgaagccctatagggagggcttcaaccaggcccggttcgcg
cgctttctggatcagctcagcggctatgggctggccctttccatcacggaattcgacgtc
gcggaccggggcgggccgcccaatccggaaaagcgggacaaggagatcgcctccgtcgcc
aaggcctttctggacgtggcgctggacaatccggccatgcggtcggtgctctgctggggg
ctgtcggaccgctatagctggctgtccaatttcaaggattacaagtggcccgacggccag
ttgtcgcgcggcctgccgcttgacggcgggatgcgccgcaagccgttgtgggacgccata
gccgccgccttcgacgcggcccccgccatgaggagcgcaggcgcatga

DBGET integrated database retrieval system