KEGG   Sphingobium japonicum: SJA_C1-19710Help
Entry
SJA_C1-19710      CDS       T01201                                 

Definition
putative limonene-1,2-epoxide hydrolase (EC:3.3.2.8)
Orthology
K10533  
limonene-1,2-epoxide hydrolase [EC:3.3.2.8]
Organism
sjp  Sphingobium japonicum
Pathway
Limonene and pinene degradation
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sjp00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    SJA_C1-19710
Enzymes [BR:sjp01000]
 3. Hydrolases
  3.3  Acting on ether bonds
   3.3.2  Ether hydrolases
    3.3.2.8  limonene-1,2-epoxide hydrolase
     SJA_C1-19710
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
1:1974256..1974693
Genome map
AA seq 145 aa AA seqDB search
MILTPADGKTDDERFVLAFLDLWDKQDVDGLIASFTQDATYKDMPLPPRVGLDAIRAYIE
RIFSAFGVRIETAHIATTGSVIFTERIDYLTQTGPNEPTVPLPVTGVMEMRDGKIAFWRD
YLDLRTAEEGLGIKIRADVEGQHIG
NT seq 438 nt NT seq  +upstreamnt  +downstreamnt
atgatcctcacccccgccgacggcaagactgacgacgaacgcttcgtgctcgccttcctc
gacctgtgggataagcaggatgtcgatgggctgatcgccagcttcacacaggacgcgacc
tataaggacatgccgctacccccgcgcgtcgggctggacgccattcgcgcctatatcgaa
cgcatattttcggcgttcggcgtgcggatcgagacggcgcacatcgccaccacgggctcg
gttatctttaccgagcggatcgactatctgacgcagactggcccgaacgaaccgaccgtc
cccttgccggtgaccggcgtcatggaaatgcgcgacggcaagattgctttctggcgcgat
tatctcgacctcaggaccgccgaggaaggtctcggcatcaagatccgcgccgacgtcgaa
ggccagcacatcggctga

DBGET integrated database retrieval system