KEGG   Sphingobium japonicum: SJA_C1-20640Help
Entry
SJA_C1-20640      CDS       T01201                                 

Gene name
pdhC
Definition
(GenBank) pyruvate dehydrogenase E2 component
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
sjp  Sphingobium japonicum
Pathway
sjp00010  Glycolysis / Gluconeogenesis
sjp00020  Citrate cycle (TCA cycle)
sjp00620  Pyruvate metabolism
sjp01100  Metabolic pathways
sjp01110  Biosynthesis of secondary metabolites
sjp01120  Microbial metabolism in diverse environments
sjp01130  Biosynthesis of antibiotics
sjp01200  Carbon metabolism
Module
sjp_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:sjp00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SJA_C1-20640 (pdhC)
   00020 Citrate cycle (TCA cycle)
    SJA_C1-20640 (pdhC)
   00620 Pyruvate metabolism
    SJA_C1-20640 (pdhC)
Enzymes [BR:sjp01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     SJA_C1-20640 (pdhC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 RnfC_N HlyD_3
Motif
Other DBs
NCBI-ProteinID: BAI96898
NITE: SJA_C1-20640
UniProt: D4Z2R6
Position
1:complement(2058023..2059306)
Genome map
AA seq 427 aa AA seqDB search
MSKTIQMPALSPTMEEGTLAKWLVKEGDTVSSGDLLAEIETDKATMEFEAVDEGTVAKIL
VAEGSEGVKVGTVIAIIAEEGEDLSQAAAGNAAPSAAAPAAGPAPQADPVPAKAPAPAPK
ADPAPAKATDGRVKASPLARRLAEAKGLDLAAVTGSGPNGRIVKADLEGAAPVAKTAVPA
AAPAAPLAAAPAAAQDFGIPHEVIKLSGMRKTIARRLTESKQQVPHIYLTVDVQLDKLLK
LRGELNAGLASRGVKLSVNDLLIKALGVALIQVPECNVQFAGDQMLKFQRADISVAVSIP
GGLITPIVTEADSKGVAAISTAMKDLAARAKDGKLKPEEYQGGTASLSNMGMFGIKQFEA
VINPPQGMILAIGAGEKRPFVIDDSLQIATVMSATGSFDHRAIDGADGARLMQVFKELVE
NPIGMLA
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atgagcaaaacgatccagatgcccgccctttctccaacgatggaagaagggacgctggcg
aaatggctggtgaaggagggcgacaccgtctcctccggcgatctgctggcggagatcgag
accgacaaggcgacgatggaattcgaagccgtagacgaaggcaccgtggccaagatactg
gtggccgaagggtcggagggggtgaaggtgggcaccgtcatcgccatcatcgcggaggag
ggcgaggatctgtcgcaagccgccgccggtaatgccgctcccagcgcagcggcccccgca
gcaggccctgcgccccaggccgatccggtgcccgccaaggccccggcgcccgcgccgaag
gccgatcccgcgccggccaaggcgacggacggcagggtgaaggccagcccgctcgcccgt
cgcctggccgaagccaaggggctggatcttgccgccgtcaccggctccggtcccaatggc
cgcatcgtgaaagccgacctggagggcgccgcgcccgtcgccaagactgccgttccggcc
gccgcgcctgccgctccgctcgccgccgcgcctgccgccgcgcaggatttcggcatcccg
cacgaggtcatcaagctcagcggcatgcgcaagaccatcgcgcgccgcctgaccgaatcc
aagcagcaggtgccgcacatctacctgaccgtggacgtgcagctcgacaagctgctgaaa
ctgcgcggcgaactgaatgcgggcctggcctcgcggggcgtcaagctgtcggtcaacgac
ctgctgatcaaggcgctgggcgtggcgctgatccaggtgccggaatgcaacgtccagttc
gctggcgaccagatgctgaaattccagcgagcggacatttcggtggccgtgtccatcccc
ggcggcctcatcacccccatcgtgacggaggcggacagcaagggcgtcgccgccatctcc
accgcgatgaaggatctcgccgcccgcgccaaggacggcaagctaaagccggaggaatat
cagggcggcaccgcctcgctctccaacatgggcatgttcggcatcaagcagttcgaggcc
gtcatcaacccgcctcagggcatgatcctggccatcggcgcgggcgagaagcggcccttc
gtcatcgatgactcgctccagatcgcgaccgtcatgtccgccaccggcagtttcgaccac
cgcgccatcgacggcgctgacggcgcccgcctgatgcaggtcttcaaggaactggtcgaa
aatccgatcgggatgctcgcctga

DBGET integrated database retrieval system