KEGG   Sphingobium japonicum: SJA_C1-20640Help
Entry
SJA_C1-20640      CDS       T01201                                 

Gene name
pdhC
Definition
pyruvate dehydrogenase E2 component (EC:2.3.1.12)
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
sjp  Sphingobium japonicum
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:sjp00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SJA_C1-20640 (pdhC)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SJA_C1-20640 (pdhC)
   00020 Citrate cycle (TCA cycle)
    SJA_C1-20640 (pdhC)
   00620 Pyruvate metabolism
    SJA_C1-20640 (pdhC)
Enzymes [BR:sjp01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     SJA_C1-20640 (pdhC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
1:complement(2058023..2059306)
Genome map
AA seq 427 aa AA seqDB search
MSKTIQMPALSPTMEEGTLAKWLVKEGDTVSSGDLLAEIETDKATMEFEAVDEGTVAKIL
VAEGSEGVKVGTVIAIIAEEGEDLSQAAAGNAAPSAAAPAAGPAPQADPVPAKAPAPAPK
ADPAPAKATDGRVKASPLARRLAEAKGLDLAAVTGSGPNGRIVKADLEGAAPVAKTAVPA
AAPAAPLAAAPAAAQDFGIPHEVIKLSGMRKTIARRLTESKQQVPHIYLTVDVQLDKLLK
LRGELNAGLASRGVKLSVNDLLIKALGVALIQVPECNVQFAGDQMLKFQRADISVAVSIP
GGLITPIVTEADSKGVAAISTAMKDLAARAKDGKLKPEEYQGGTASLSNMGMFGIKQFEA
VINPPQGMILAIGAGEKRPFVIDDSLQIATVMSATGSFDHRAIDGADGARLMQVFKELVE
NPIGMLA
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atgagcaaaacgatccagatgcccgccctttctccaacgatggaagaagggacgctggcg
aaatggctggtgaaggagggcgacaccgtctcctccggcgatctgctggcggagatcgag
accgacaaggcgacgatggaattcgaagccgtagacgaaggcaccgtggccaagatactg
gtggccgaagggtcggagggggtgaaggtgggcaccgtcatcgccatcatcgcggaggag
ggcgaggatctgtcgcaagccgccgccggtaatgccgctcccagcgcagcggcccccgca
gcaggccctgcgccccaggccgatccggtgcccgccaaggccccggcgcccgcgccgaag
gccgatcccgcgccggccaaggcgacggacggcagggtgaaggccagcccgctcgcccgt
cgcctggccgaagccaaggggctggatcttgccgccgtcaccggctccggtcccaatggc
cgcatcgtgaaagccgacctggagggcgccgcgcccgtcgccaagactgccgttccggcc
gccgcgcctgccgctccgctcgccgccgcgcctgccgccgcgcaggatttcggcatcccg
cacgaggtcatcaagctcagcggcatgcgcaagaccatcgcgcgccgcctgaccgaatcc
aagcagcaggtgccgcacatctacctgaccgtggacgtgcagctcgacaagctgctgaaa
ctgcgcggcgaactgaatgcgggcctggcctcgcggggcgtcaagctgtcggtcaacgac
ctgctgatcaaggcgctgggcgtggcgctgatccaggtgccggaatgcaacgtccagttc
gctggcgaccagatgctgaaattccagcgagcggacatttcggtggccgtgtccatcccc
ggcggcctcatcacccccatcgtgacggaggcggacagcaagggcgtcgccgccatctcc
accgcgatgaaggatctcgccgcccgcgccaaggacggcaagctaaagccggaggaatat
cagggcggcaccgcctcgctctccaacatgggcatgttcggcatcaagcagttcgaggcc
gtcatcaacccgcctcagggcatgatcctggccatcggcgcgggcgagaagcggcccttc
gtcatcgatgactcgctccagatcgcgaccgtcatgtccgccaccggcagtttcgaccac
cgcgccatcgacggcgctgacggcgcccgcctgatgcaggtcttcaaggaactggtcgaa
aatccgatcgggatgctcgcctga

DBGET integrated database retrieval system