KEGG   Sphingobium japonicum: SJA_C1-20800Help
Entry
SJA_C1-20800      CDS       T01201                                 

Gene name
fadB
Definition
3-hydroxyacyl-CoA dehydrogenase (EC:1.1.1.35)
Orthology
K01782  
3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
sjp  Sphingobium japonicum
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Tryptophan metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Biosynthesis of unsaturated fatty acids
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:sjp00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SJA_C1-20800 (fadB)
   01212 Fatty acid metabolism
    SJA_C1-20800 (fadB)
  Carbohydrate metabolism
   00640 Propanoate metabolism
    SJA_C1-20800 (fadB)
   00650 Butanoate metabolism
    SJA_C1-20800 (fadB)
  Lipid metabolism
   00071 Fatty acid degradation
    SJA_C1-20800 (fadB)
   01040 Biosynthesis of unsaturated fatty acids
    SJA_C1-20800 (fadB)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SJA_C1-20800 (fadB)
   00310 Lysine degradation
    SJA_C1-20800 (fadB)
   00380 Tryptophan metabolism
    SJA_C1-20800 (fadB)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    SJA_C1-20800 (fadB)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    SJA_C1-20800 (fadB)
   00281 Geraniol degradation
    SJA_C1-20800 (fadB)
  Xenobiotics biodegradation and metabolism
   00930 Caprolactam degradation
    SJA_C1-20800 (fadB)
Enzymes [BR:sjp01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     SJA_C1-20800 (fadB)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     SJA_C1-20800 (fadB)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     SJA_C1-20800 (fadB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
1:2073446..2075623
Genome map
AA seq 725 aa AA seqDB search
MQSINFDIDRDGIATLTIDVPGQSMNVIGPDFMADLDAAITRIASEEAIRGAVIASGKDS
GFMAGMDLKYFGSMLGGESGKRPSPAAIFDKVFVLNQLLRRLETCGKPVACAIEGTCVGG
GFELALACHRRVVGDSPKTQLGLPEILIGLFPGGGGSQRLPRIMGVQASLMYMLQGKLFR
PAEAAMMKVVDEVVPQGMAVEKAKDCVKANPNASVQPWDVKGFKVPGGAGGFNPGFAQTM
AGALPMTLKQTQRNMNAPIALLSAVYEGITLPMDRAVRIESKYFAKVAADPQAANMVRSL
FVNKQAAERGARRPKDQPKAPTKKLAMLGAGMMGAGIATVAAQAGMEVVLFDRDQAYAEK
GKAHVEEVLKKRLGKGLTPEKMAETLARVTPTTDYAALAGADFVIEAVFEDVAIKAEVTK
KVEEVLGADIIFGSNTSTLPITKLARAWSKPENFIGVHFFSPVEKMPLVEIILGKETGPA
AIAKALDFVSQIRKTPIVVNDARGFYTSRCFATYVQEGVEMVAEGINPALIENAGRQLGM
PVGPLAVGDEVSLELAHKIIVAARKELGDAYVAQPSDAVMERMVGLGRLGRKSAKGWYDY
PEGGKKHLWPGLAEMFPPAAVQPGVEAVKERLLYRQLIECARCFEEGVLETPEDGDIGAI
FGWGFAPYTGGPFSHMDTVGIAAVVAVLDRLAAAHGGRFAPTAQLREMAASGATFYRPVS
SRAAA
NT seq 2178 nt NT seq  +upstreamnt  +downstreamnt
atgcagagcatcaatttcgacatcgaccgcgacggcatcgccacgctgaccatcgacgtt
cccggccagtccatgaacgtcatcgggccggatttcatggccgatctggacgcggcgatc
acgcgcatcgcttccgaggaggcgatcaggggcgcggtgatcgcgtcgggcaaggacagc
gggttcatggcgggcatggacctgaaatatttcgggtcgatgctgggcggcgagagcggg
aagcgcccctcccccgccgcgatcttcgacaaggtcttcgtgctgaaccagttgctccgg
cggctggagacatgcggcaagccggtggcctgcgccatagagggcacctgcgtcggcggc
gggttcgaactggcgctggcctgtcaccgccgcgtggtgggcgacagcccgaagacgcag
cttggcctgccggaaatattgatcggcctgttccccggcggcggcgggtcgcagcgcctg
ccgcgcatcatgggcgtgcaggcgtcgctgatgtatatgttgcagggcaagctgttccgt
cccgccgaagcggcgatgatgaaggtcgtcgatgaggtcgtgccgcagggcatggcggtc
gaaaaggcgaaggactgtgtgaaggcgaaccccaacgcatcggtgcagccgtgggacgtc
aagggattcaaggtgccgggcggcgcgggcgggttcaaccccggcttcgcgcagaccatg
gcgggcgccctgccgatgacgctgaagcagacccagcgcaacatgaacgcgccgatcgcg
ctgctgtccgccgtctatgaaggcatcaccctgcccatggatcgcgccgtccggatcgag
agcaaatatttcgccaaggtcgcggccgacccgcaggcggcgaacatggtccgcagcctg
ttcgtcaacaagcaggcggccgagcgcggggcgcggcggcccaaggaccagcccaaggcg
ccgacgaagaagctggccatgctgggcgcgggcatgatgggcgcgggcatcgccaccgtc
gccgcgcaggcgggcatggaggtcgtgctgttcgaccgcgaccaggcctatgccgaaaag
ggcaaggcgcatgtcgaggaggtgctgaagaagcggctgggcaagggtctgacgccggag
aagatggcggagacgctggcccgcgtgacgccgaccaccgactatgcggcgctggccggg
gcggacttcgtgatcgaggcggtgttcgaggatgtcgccatcaaggcggaggtgacgaag
aaggtggaggaagtgctgggcgcggacatcatcttcgggtccaacacctccactttgccg
atcaccaagctggccagggcatggtcgaagccggagaatttcatcggcgtccatttcttc
tctccggtcgagaagatgccgctggtggagatcatcctgggcaaggaaaccggcccggcc
gccatcgccaaggcgctggatttcgtcagccagatccgcaagacgcccatcgtcgtcaat
gatgcgcgcggcttctacacctcgcgctgcttcgccacctatgtgcaggaaggcgtggag
atggtggcggaggggatcaacccggcgctgatcgaaaatgccgggcggcaactgggcatg
cccgtggggccgctggccgtgggggacgaggtttcgctggagctggcccacaagatcatc
gtcgcggcgcgcaaggaactgggcgacgcctatgtcgcgcagccgtccgacgcggtgatg
gaacggatggtcggactgggacggctgggccgcaagagcgccaagggctggtatgactat
cccgaaggcgggaagaagcatctgtggccgggcctggcggagatgttcccgcccgccgcc
gtgcagcccggcgtggaggcggttaaggagcggctgctctatcgccagttgatcgaatgc
gcccgctgttttgaagaaggcgtgctggagacgccggaggacggcgacatcggcgcgatc
ttcggctggggcttcgcgccctataccggcgggccgttcagccatatggatacggtcggc
atcgctgctgtcgtggcggtgctggaccggctggcggcggcgcatgggggacggttcgcc
cccaccgcgcagttgcgggagatggcggccagcggcgcgaccttctatcggcccgtttcg
tcccgcgccgccgcatga

  All links  
No link information was found.   
DBGET integrated database retrieval system