KEGG   Sphingobium japonicum: SJA_C1-20800Help
Entry
SJA_C1-20800      CDS       T01201                                 

Gene name
fadB
Definition
3-hydroxyacyl-CoA dehydrogenase (EC:1.1.1.35)
Orthology
K01782  
3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
sjp  Sphingobium japonicum
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Tryptophan metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Biosynthesis of unsaturated fatty acids
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Fatty acid metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:sjp01200]
Metabolism; Overview; Fatty acid metabolism [PATH:sjp01212]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:sjp00640]
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:sjp00650]
Metabolism; Lipid metabolism; Fatty acid degradation [PATH:sjp00071]
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:sjp01040]
Metabolism; Amino acid metabolism; Valine, leucine and isoleucine degradation [PATH:sjp00280]
Metabolism; Amino acid metabolism; Lysine degradation [PATH:sjp00310]
Metabolism; Amino acid metabolism; Tryptophan metabolism [PATH:sjp00380]
Metabolism; Metabolism of other amino acids; beta-Alanine metabolism [PATH:sjp00410]
Metabolism; Metabolism of terpenoids and polyketides; Limonene and pinene degradation [PATH:sjp00903]
Metabolism; Metabolism of terpenoids and polyketides; Geraniol degradation [PATH:sjp00281]
Metabolism; Xenobiotics biodegradation and metabolism; Caprolactam degradation [PATH:sjp00930]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
1:2073446..2075623
Genome map
AA seq 725 aa AA seqDB search
MQSINFDIDRDGIATLTIDVPGQSMNVIGPDFMADLDAAITRIASEEAIRGAVIASGKDS
GFMAGMDLKYFGSMLGGESGKRPSPAAIFDKVFVLNQLLRRLETCGKPVACAIEGTCVGG
GFELALACHRRVVGDSPKTQLGLPEILIGLFPGGGGSQRLPRIMGVQASLMYMLQGKLFR
PAEAAMMKVVDEVVPQGMAVEKAKDCVKANPNASVQPWDVKGFKVPGGAGGFNPGFAQTM
AGALPMTLKQTQRNMNAPIALLSAVYEGITLPMDRAVRIESKYFAKVAADPQAANMVRSL
FVNKQAAERGARRPKDQPKAPTKKLAMLGAGMMGAGIATVAAQAGMEVVLFDRDQAYAEK
GKAHVEEVLKKRLGKGLTPEKMAETLARVTPTTDYAALAGADFVIEAVFEDVAIKAEVTK
KVEEVLGADIIFGSNTSTLPITKLARAWSKPENFIGVHFFSPVEKMPLVEIILGKETGPA
AIAKALDFVSQIRKTPIVVNDARGFYTSRCFATYVQEGVEMVAEGINPALIENAGRQLGM
PVGPLAVGDEVSLELAHKIIVAARKELGDAYVAQPSDAVMERMVGLGRLGRKSAKGWYDY
PEGGKKHLWPGLAEMFPPAAVQPGVEAVKERLLYRQLIECARCFEEGVLETPEDGDIGAI
FGWGFAPYTGGPFSHMDTVGIAAVVAVLDRLAAAHGGRFAPTAQLREMAASGATFYRPVS
SRAAA
NT seq 2178 nt NT seq  +upstreamnt  +downstreamnt
atgcagagcatcaatttcgacatcgaccgcgacggcatcgccacgctgaccatcgacgtt
cccggccagtccatgaacgtcatcgggccggatttcatggccgatctggacgcggcgatc
acgcgcatcgcttccgaggaggcgatcaggggcgcggtgatcgcgtcgggcaaggacagc
gggttcatggcgggcatggacctgaaatatttcgggtcgatgctgggcggcgagagcggg
aagcgcccctcccccgccgcgatcttcgacaaggtcttcgtgctgaaccagttgctccgg
cggctggagacatgcggcaagccggtggcctgcgccatagagggcacctgcgtcggcggc
gggttcgaactggcgctggcctgtcaccgccgcgtggtgggcgacagcccgaagacgcag
cttggcctgccggaaatattgatcggcctgttccccggcggcggcgggtcgcagcgcctg
ccgcgcatcatgggcgtgcaggcgtcgctgatgtatatgttgcagggcaagctgttccgt
cccgccgaagcggcgatgatgaaggtcgtcgatgaggtcgtgccgcagggcatggcggtc
gaaaaggcgaaggactgtgtgaaggcgaaccccaacgcatcggtgcagccgtgggacgtc
aagggattcaaggtgccgggcggcgcgggcgggttcaaccccggcttcgcgcagaccatg
gcgggcgccctgccgatgacgctgaagcagacccagcgcaacatgaacgcgccgatcgcg
ctgctgtccgccgtctatgaaggcatcaccctgcccatggatcgcgccgtccggatcgag
agcaaatatttcgccaaggtcgcggccgacccgcaggcggcgaacatggtccgcagcctg
ttcgtcaacaagcaggcggccgagcgcggggcgcggcggcccaaggaccagcccaaggcg
ccgacgaagaagctggccatgctgggcgcgggcatgatgggcgcgggcatcgccaccgtc
gccgcgcaggcgggcatggaggtcgtgctgttcgaccgcgaccaggcctatgccgaaaag
ggcaaggcgcatgtcgaggaggtgctgaagaagcggctgggcaagggtctgacgccggag
aagatggcggagacgctggcccgcgtgacgccgaccaccgactatgcggcgctggccggg
gcggacttcgtgatcgaggcggtgttcgaggatgtcgccatcaaggcggaggtgacgaag
aaggtggaggaagtgctgggcgcggacatcatcttcgggtccaacacctccactttgccg
atcaccaagctggccagggcatggtcgaagccggagaatttcatcggcgtccatttcttc
tctccggtcgagaagatgccgctggtggagatcatcctgggcaaggaaaccggcccggcc
gccatcgccaaggcgctggatttcgtcagccagatccgcaagacgcccatcgtcgtcaat
gatgcgcgcggcttctacacctcgcgctgcttcgccacctatgtgcaggaaggcgtggag
atggtggcggaggggatcaacccggcgctgatcgaaaatgccgggcggcaactgggcatg
cccgtggggccgctggccgtgggggacgaggtttcgctggagctggcccacaagatcatc
gtcgcggcgcgcaaggaactgggcgacgcctatgtcgcgcagccgtccgacgcggtgatg
gaacggatggtcggactgggacggctgggccgcaagagcgccaagggctggtatgactat
cccgaaggcgggaagaagcatctgtggccgggcctggcggagatgttcccgcccgccgcc
gtgcagcccggcgtggaggcggttaaggagcggctgctctatcgccagttgatcgaatgc
gcccgctgttttgaagaaggcgtgctggagacgccggaggacggcgacatcggcgcgatc
ttcggctggggcttcgcgccctataccggcgggccgttcagccatatggatacggtcggc
atcgctgctgtcgtggcggtgctggaccggctggcggcggcgcatgggggacggttcgcc
cccaccgcgcagttgcgggagatggcggccagcggcgcgaccttctatcggcccgtttcg
tcccgcgccgccgcatga

DBGET integrated database retrieval system