KEGG   Sphingobium japonicum: SJA_C1-20800Help
Entry
SJA_C1-20800      CDS       T01201                                 

Gene name
fadB
Definition
(GenBank) 3-hydroxyacyl-CoA dehydrogenase
  KO
K01782  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
sjp  Sphingobium japonicum
Pathway
sjp00071  Fatty acid degradation
sjp00280  Valine, leucine and isoleucine degradation
sjp00281  Geraniol degradation
sjp00310  Lysine degradation
sjp00362  Benzoate degradation
sjp00380  Tryptophan metabolism
sjp00410  beta-Alanine metabolism
sjp00640  Propanoate metabolism
sjp00650  Butanoate metabolism
sjp00903  Limonene and pinene degradation
sjp00930  Caprolactam degradation
sjp01040  Biosynthesis of unsaturated fatty acids
sjp01100  Metabolic pathways
sjp01110  Biosynthesis of secondary metabolites
sjp01120  Microbial metabolism in diverse environments
sjp01130  Biosynthesis of antibiotics
sjp01200  Carbon metabolism
sjp01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:sjp00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    SJA_C1-20800 (fadB)
   00650 Butanoate metabolism
    SJA_C1-20800 (fadB)
  Lipid metabolism
   00071 Fatty acid degradation
    SJA_C1-20800 (fadB)
   01040 Biosynthesis of unsaturated fatty acids
    SJA_C1-20800 (fadB)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SJA_C1-20800 (fadB)
   00310 Lysine degradation
    SJA_C1-20800 (fadB)
   00380 Tryptophan metabolism
    SJA_C1-20800 (fadB)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    SJA_C1-20800 (fadB)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    SJA_C1-20800 (fadB)
   00281 Geraniol degradation
    SJA_C1-20800 (fadB)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    SJA_C1-20800 (fadB)
   00930 Caprolactam degradation
    SJA_C1-20800 (fadB)
Enzymes [BR:sjp01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     SJA_C1-20800 (fadB)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     SJA_C1-20800 (fadB)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     SJA_C1-20800 (fadB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2 NAD_binding_2 NAD_Gly3P_dh_N F420_oxidored 2-Hacid_dh_C Pyr_redox_2 UDPG_MGDP_dh_N XdhC_C Shikimate_DH Sacchrp_dh_NADP NAD_binding_8 AlaDh_PNT_C
Motif
Other DBs
NCBI-ProteinID: BAI96914
NITE: SJA_C1-20800
UniProt: D4Z2T2
Position
1:2073446..2075623
Genome map
AA seq 725 aa AA seqDB search
MQSINFDIDRDGIATLTIDVPGQSMNVIGPDFMADLDAAITRIASEEAIRGAVIASGKDS
GFMAGMDLKYFGSMLGGESGKRPSPAAIFDKVFVLNQLLRRLETCGKPVACAIEGTCVGG
GFELALACHRRVVGDSPKTQLGLPEILIGLFPGGGGSQRLPRIMGVQASLMYMLQGKLFR
PAEAAMMKVVDEVVPQGMAVEKAKDCVKANPNASVQPWDVKGFKVPGGAGGFNPGFAQTM
AGALPMTLKQTQRNMNAPIALLSAVYEGITLPMDRAVRIESKYFAKVAADPQAANMVRSL
FVNKQAAERGARRPKDQPKAPTKKLAMLGAGMMGAGIATVAAQAGMEVVLFDRDQAYAEK
GKAHVEEVLKKRLGKGLTPEKMAETLARVTPTTDYAALAGADFVIEAVFEDVAIKAEVTK
KVEEVLGADIIFGSNTSTLPITKLARAWSKPENFIGVHFFSPVEKMPLVEIILGKETGPA
AIAKALDFVSQIRKTPIVVNDARGFYTSRCFATYVQEGVEMVAEGINPALIENAGRQLGM
PVGPLAVGDEVSLELAHKIIVAARKELGDAYVAQPSDAVMERMVGLGRLGRKSAKGWYDY
PEGGKKHLWPGLAEMFPPAAVQPGVEAVKERLLYRQLIECARCFEEGVLETPEDGDIGAI
FGWGFAPYTGGPFSHMDTVGIAAVVAVLDRLAAAHGGRFAPTAQLREMAASGATFYRPVS
SRAAA
NT seq 2178 nt NT seq  +upstreamnt  +downstreamnt
atgcagagcatcaatttcgacatcgaccgcgacggcatcgccacgctgaccatcgacgtt
cccggccagtccatgaacgtcatcgggccggatttcatggccgatctggacgcggcgatc
acgcgcatcgcttccgaggaggcgatcaggggcgcggtgatcgcgtcgggcaaggacagc
gggttcatggcgggcatggacctgaaatatttcgggtcgatgctgggcggcgagagcggg
aagcgcccctcccccgccgcgatcttcgacaaggtcttcgtgctgaaccagttgctccgg
cggctggagacatgcggcaagccggtggcctgcgccatagagggcacctgcgtcggcggc
gggttcgaactggcgctggcctgtcaccgccgcgtggtgggcgacagcccgaagacgcag
cttggcctgccggaaatattgatcggcctgttccccggcggcggcgggtcgcagcgcctg
ccgcgcatcatgggcgtgcaggcgtcgctgatgtatatgttgcagggcaagctgttccgt
cccgccgaagcggcgatgatgaaggtcgtcgatgaggtcgtgccgcagggcatggcggtc
gaaaaggcgaaggactgtgtgaaggcgaaccccaacgcatcggtgcagccgtgggacgtc
aagggattcaaggtgccgggcggcgcgggcgggttcaaccccggcttcgcgcagaccatg
gcgggcgccctgccgatgacgctgaagcagacccagcgcaacatgaacgcgccgatcgcg
ctgctgtccgccgtctatgaaggcatcaccctgcccatggatcgcgccgtccggatcgag
agcaaatatttcgccaaggtcgcggccgacccgcaggcggcgaacatggtccgcagcctg
ttcgtcaacaagcaggcggccgagcgcggggcgcggcggcccaaggaccagcccaaggcg
ccgacgaagaagctggccatgctgggcgcgggcatgatgggcgcgggcatcgccaccgtc
gccgcgcaggcgggcatggaggtcgtgctgttcgaccgcgaccaggcctatgccgaaaag
ggcaaggcgcatgtcgaggaggtgctgaagaagcggctgggcaagggtctgacgccggag
aagatggcggagacgctggcccgcgtgacgccgaccaccgactatgcggcgctggccggg
gcggacttcgtgatcgaggcggtgttcgaggatgtcgccatcaaggcggaggtgacgaag
aaggtggaggaagtgctgggcgcggacatcatcttcgggtccaacacctccactttgccg
atcaccaagctggccagggcatggtcgaagccggagaatttcatcggcgtccatttcttc
tctccggtcgagaagatgccgctggtggagatcatcctgggcaaggaaaccggcccggcc
gccatcgccaaggcgctggatttcgtcagccagatccgcaagacgcccatcgtcgtcaat
gatgcgcgcggcttctacacctcgcgctgcttcgccacctatgtgcaggaaggcgtggag
atggtggcggaggggatcaacccggcgctgatcgaaaatgccgggcggcaactgggcatg
cccgtggggccgctggccgtgggggacgaggtttcgctggagctggcccacaagatcatc
gtcgcggcgcgcaaggaactgggcgacgcctatgtcgcgcagccgtccgacgcggtgatg
gaacggatggtcggactgggacggctgggccgcaagagcgccaagggctggtatgactat
cccgaaggcgggaagaagcatctgtggccgggcctggcggagatgttcccgcccgccgcc
gtgcagcccggcgtggaggcggttaaggagcggctgctctatcgccagttgatcgaatgc
gcccgctgttttgaagaaggcgtgctggagacgccggaggacggcgacatcggcgcgatc
ttcggctggggcttcgcgccctataccggcgggccgttcagccatatggatacggtcggc
atcgctgctgtcgtggcggtgctggaccggctggcggcggcgcatgggggacggttcgcc
cccaccgcgcagttgcgggagatggcggccagcggcgcgaccttctatcggcccgtttcg
tcccgcgccgccgcatga

DBGET integrated database retrieval system