KEGG   Sphingobium japonicum: SJA_C1-21360Help
Entry
SJA_C1-21360      CDS       T01201                                 

Gene name
trpB
Definition
(GenBank) tryptophan synthase beta chain (EC:4.2.1.20)
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
sjp  Sphingobium japonicum
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:sjp00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    SJA_C1-21360 (trpB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SJA_C1-21360 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SJA_C1-21360 (trpB)
Enzymes [BR:sjp01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     SJA_C1-21360 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NITE: 
UniProt: 
Position
1:2139238..2140521
Genome map
AA seq 427 aa AA seqDB search
MAQVIQPMPEETEAMTDSMTLPNSLRSQPDASGHFGAFGGRYVAETLMPLILELEKVYKE
AKQDPAFDAEFTELLRSYVGRPNPLYHAARLTEALRAEAPPGKGAKIYLKREELNHTGAH
KINNCIGQALLARRMGKKKVIAETGAGQHGVATATVAALFGMECKIFMGAKDVERQKPNV
FRMKLLGAEVIPVVSGSQTLKDAMNDALRHWVSNVHDTFYIIGTAAGPHPYPELVRDFQS
IIGREAREQILELEGRLPDMLIAPVGGGSNAIGLFHPFLDDAEVKMIGVEAAGEGLQGKH
AASLAGGKSGILHGNRTYLLQDEDGQITEAHSISAGLDYPGIGPEHSWLHEIGRVDYMPI
TDDEALASFQKLSALEGIIPALESAHAIASAEKVAPTLDADQILIVNLSGRGDKDIFTVA
TALGVEI
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
ttggcccaagtgatccaacccatgcccgaagagacagaagcgatgaccgatagcatgacc
ctgcccaacagcctgcgttcgcagcccgacgcctccggccatttcggcgcctttggcggc
cgttacgtggccgaaaccctgatgccgctcatcctggagctggagaaggtgtacaaggag
gcgaagcaggaccccgccttcgacgcggaattcaccgaattgctgcgcagctatgtcggc
cgcccgaacccgctttaccatgccgcgcgcctgaccgaggcgctgcgcgccgaagcgccg
cccggcaagggcgcgaaaatctatctgaagcgcgaggagctgaaccacaccggcgcgcac
aagatcaacaattgcatcggccaggcgctgctggcccgccgcatgggcaagaagaaggtc
atcgccgaaaccggcgcgggccagcacggcgtcgcgaccgcgaccgtcgccgcgctgttc
ggcatggaatgcaagatcttcatgggcgcgaaggacgtggagcggcagaagcccaacgtc
ttccgcatgaagctgctgggcgcggaggtgatcccggtcgtttcgggatcgcagaccctg
aaggacgctatgaacgatgcgctgcgccattgggtgtcgaacgtccacgacaccttctac
atcatcggcacggcggccgggccgcacccctatcccgaactggtgcgcgatttccagtcg
atcatcggccgggaggcgcgcgagcagatactggaactggaaggccgcctgcccgacatg
ctgatcgcgccggtcggcggcggctccaacgccatcggcctgttccaccccttcctggac
gatgcggaggtcaagatgatcggcgtcgaagcagcgggcgaaggattgcagggcaagcat
gccgcctccctcgcgggcggcaagtccggcatattgcacggcaaccgcacctacctgctc
caggacgaggacgggcagatcaccgaggcgcacagcatctcggccggcctggattatccc
ggcatcgggcctgaacatagctggctgcatgaaatcggccgggtcgactatatgccgatc
accgacgatgaggcgctggccagcttccagaagctctccgcgctggaggggatcatcccg
gcgctggaatcggcgcacgccatcgccagcgcggaaaaggtcgcgccgacgctggacgcc
gaccagatattgatcgtcaacctctccggccgcggcgacaaggacatcttcaccgtggcg
accgctttgggggtggagatatga

DBGET integrated database retrieval system