KEGG   Sphingobium japonicum: SJA_C1-21360Help
Entry
SJA_C1-21360      CDS       T01201                                 

Gene name
trpB
Definition
(GenBank) tryptophan synthase beta chain
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
sjp  Sphingobium japonicum
Pathway
sjp00260  Glycine, serine and threonine metabolism
sjp00400  Phenylalanine, tyrosine and tryptophan biosynthesis
sjp01100  Metabolic pathways
sjp01110  Biosynthesis of secondary metabolites
sjp01130  Biosynthesis of antibiotics
sjp01230  Biosynthesis of amino acids
Module
sjp_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:sjp00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SJA_C1-21360 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SJA_C1-21360 (trpB)
Enzymes [BR:sjp01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     SJA_C1-21360 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: BAI96970
NITE: SJA_C1-21360
UniProt: D4Z2Y8
Position
1:2139238..2140521
Genome map
AA seq 427 aa AA seqDB search
MAQVIQPMPEETEAMTDSMTLPNSLRSQPDASGHFGAFGGRYVAETLMPLILELEKVYKE
AKQDPAFDAEFTELLRSYVGRPNPLYHAARLTEALRAEAPPGKGAKIYLKREELNHTGAH
KINNCIGQALLARRMGKKKVIAETGAGQHGVATATVAALFGMECKIFMGAKDVERQKPNV
FRMKLLGAEVIPVVSGSQTLKDAMNDALRHWVSNVHDTFYIIGTAAGPHPYPELVRDFQS
IIGREAREQILELEGRLPDMLIAPVGGGSNAIGLFHPFLDDAEVKMIGVEAAGEGLQGKH
AASLAGGKSGILHGNRTYLLQDEDGQITEAHSISAGLDYPGIGPEHSWLHEIGRVDYMPI
TDDEALASFQKLSALEGIIPALESAHAIASAEKVAPTLDADQILIVNLSGRGDKDIFTVA
TALGVEI
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
ttggcccaagtgatccaacccatgcccgaagagacagaagcgatgaccgatagcatgacc
ctgcccaacagcctgcgttcgcagcccgacgcctccggccatttcggcgcctttggcggc
cgttacgtggccgaaaccctgatgccgctcatcctggagctggagaaggtgtacaaggag
gcgaagcaggaccccgccttcgacgcggaattcaccgaattgctgcgcagctatgtcggc
cgcccgaacccgctttaccatgccgcgcgcctgaccgaggcgctgcgcgccgaagcgccg
cccggcaagggcgcgaaaatctatctgaagcgcgaggagctgaaccacaccggcgcgcac
aagatcaacaattgcatcggccaggcgctgctggcccgccgcatgggcaagaagaaggtc
atcgccgaaaccggcgcgggccagcacggcgtcgcgaccgcgaccgtcgccgcgctgttc
ggcatggaatgcaagatcttcatgggcgcgaaggacgtggagcggcagaagcccaacgtc
ttccgcatgaagctgctgggcgcggaggtgatcccggtcgtttcgggatcgcagaccctg
aaggacgctatgaacgatgcgctgcgccattgggtgtcgaacgtccacgacaccttctac
atcatcggcacggcggccgggccgcacccctatcccgaactggtgcgcgatttccagtcg
atcatcggccgggaggcgcgcgagcagatactggaactggaaggccgcctgcccgacatg
ctgatcgcgccggtcggcggcggctccaacgccatcggcctgttccaccccttcctggac
gatgcggaggtcaagatgatcggcgtcgaagcagcgggcgaaggattgcagggcaagcat
gccgcctccctcgcgggcggcaagtccggcatattgcacggcaaccgcacctacctgctc
caggacgaggacgggcagatcaccgaggcgcacagcatctcggccggcctggattatccc
ggcatcgggcctgaacatagctggctgcatgaaatcggccgggtcgactatatgccgatc
accgacgatgaggcgctggccagcttccagaagctctccgcgctggaggggatcatcccg
gcgctggaatcggcgcacgccatcgccagcgcggaaaaggtcgcgccgacgctggacgcc
gaccagatattgatcgtcaacctctccggccgcggcgacaaggacatcttcaccgtggcg
accgctttgggggtggagatatga

DBGET integrated database retrieval system