KEGG   Sphingobium japonicum: SJA_C1-21370Help
Entry
SJA_C1-21370      CDS       T01201                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase alpha chain
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
sjp  Sphingobium japonicum
Pathway
sjp00260  Glycine, serine and threonine metabolism
sjp00400  Phenylalanine, tyrosine and tryptophan biosynthesis
sjp01100  Metabolic pathways
sjp01110  Biosynthesis of secondary metabolites
sjp01130  Biosynthesis of antibiotics
sjp01230  Biosynthesis of amino acids
Module
sjp_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:sjp00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SJA_C1-21370 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SJA_C1-21370 (trpA)
Enzymes [BR:sjp01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     SJA_C1-21370 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA His_biosynth PcrB BtpA
Motif
Other DBs
NCBI-ProteinID: BAI96971
NITE: SJA_C1-21370
UniProt: D4Z2Y9
Position
1:2140663..2141490
Genome map
AA seq 275 aa AA seqDB search
MTDRLATRFAACKKAGRAALVTFVTAGDPTVADTPAILDALVEGGADIIELGMPFTDPMA
DGPAIELANLRSLGSGTRTKDIFALAAAFRARHPETPLVLMGYANPMLVRGSAWFAEQCK
TAGVDGVICVDVPPEEDAEIGPALRAAGVHLIRLATPTTDAARLPAVLNGASGFLYHVAV
AGITGKQQAAQAAVEQAVAKLKAATDLPIAVGFGVRSAEQAAAIGRVADGVVVGSAIVDI
IGSHGDAAAPFVKDFVAALRGALNANSPHFRETAA
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
atgactgaccgcctcgccacccgcttcgccgcctgcaaaaaggcgggccgcgccgcgctc
gtcactttcgtgaccgcaggcgatccgaccgtggccgacacccccgcgatcctcgacgcg
ctggtggaagggggcgcggacatcatcgaactcggcatgcccttcaccgatccgatggcc
gatggcccggccatcgaactggcgaacctgcgcagccttggctccggcaccaggacgaag
gacatcttcgccctcgccgccgcctttcgcgccaggcacccggaaaccccgctggtcctg
atgggctatgccaacccgatgctcgtgcgcggctcggcatggttcgcggagcagtgcaag
accgcgggcgtcgatggcgtcatctgcgtcgatgtcccgccggaggaagatgccgagatc
ggccccgccctgcgcgcggccggcgtccacctgatccgcctggcgacgccgacgaccgac
gccgccaggctgcccgccgtgctgaacggcgccagcggtttcctctaccatgtcgccgtc
gccggcatcaccggcaagcagcaggccgcgcaggccgccgtcgagcaggccgtcgcgaag
ctcaaggccgccaccgacctgccgatcgccgtgggcttcggcgtgcgctccgccgaacag
gcggccgcgatcggacgcgtcgccgacggcgtggtggtgggttccgccattgtcgacatc
atcggatcgcatggcgatgccgccgcgcccttcgtcaaggatttcgtcgccgcccttcgg
ggcgcgctgaacgccaacagcccacatttccgggagaccgccgcatga

DBGET integrated database retrieval system