KEGG   Sphingobium japonicum: SJA_C1-21600Help
Entry
SJA_C1-21600      CDS       T01201                                 

Gene name
aceB
Definition
malate synthase (EC:2.3.3.9)
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
sjp  Sphingobium japonicum
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:sjp00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SJA_C1-21600 (aceB)
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    SJA_C1-21600 (aceB)
   00630 Glyoxylate and dicarboxylate metabolism
    SJA_C1-21600 (aceB)
Enzymes [BR:sjp01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     SJA_C1-21600 (aceB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
1:complement(2163383..2165545)
Genome map
AA seq 720 aa AA seqDB search
MTSMTERAGLKVAPQLAAFIEDRALPGTGIDAAAFWQGTAAIFAKFAPENAALLARRDAL
QAQIDAWHREKAGQPFDAAAYQGFLRQIDYLVPEPAPFRIGSANVDDEVARLAGPQLVVP
ILNARFLLNAANARWGSLYDALYGTDALPGAPSGKGYDPARGAQVIAWAKDFLDRAVPLK
GHAGWSDIVRLHVWNGELHLHIKGAHGVVATSLEQADGFAGYRGAPEDPTAILLRHNGLH
IELVIDRSHPIGGGDPAGIADIILESALTTICDLEDSVAAVDADDKVAAYSNWLGLMQGN
LVDTFEKNGAMMTRALNPDRSYIAPKGGVFTLPGRSLLFVRNVGHLMTTPAVLLADGAQA
PEGIVDGIVTSLIALHDLKRAGGNSRAGSVYIVKPKMHGPEEVGFTNRLFDAIEDLLGLD
RHTLKVGVMDEERRTSANLAACIAAVKDRIVFINTGFLDRTGDEMHTSMHAGPMIRKGEM
KASDWITAYEDRNVQIGLACGLSGRAQIGKGMWAAPDRMADMLDQKIGHPKSGANTAWVP
SPTAATLHATHYHGVNVLERQDDRAKEAVAPLDKLLTIPVAQGRNWSEEEITQELDNNAQ
GILGYVVRWIDQGVGCSKVPDIHDIGLMEDRATLRISSQHMANWLLHGVCTAEQVDAAFT
RMAAKVDAQNAGDPLYRPMSGHPESLAWQAARALVFEGVSQPNGYTEPLLHKYRALAKAL
NT seq 2163 nt NT seq  +upstreamnt  +downstreamnt
atgaccagcatgacagagcgcgcaggcctgaaggtcgcgccgcaactcgccgccttcatc
gaggatcgggcgcttcccggcacgggcatcgacgccgccgccttctggcaggggaccgcc
gcgatcttcgcgaaattcgccccggaaaacgccgccctgctcgcccggcgcgacgcgctc
caggcgcagatcgacgcctggcaccgggaaaaagcggggcagcccttcgacgccgccgcc
tatcagggcttcctgcgccagatcgactatctcgtccccgaacccgcgccgttccggatc
ggcagcgcgaatgtcgacgatgaagtcgcccgcctggccggaccgcaactggtcgtcccc
atcctcaacgcccgcttcctgctgaacgccgccaatgcgcgctggggcagcctgtacgat
gcgctctacggcacggacgcgctgcccggcgcgccgtcgggcaaggggtacgacccggcg
cgcggcgcgcaggtcatcgcctgggccaaggatttcctggaccgcgccgtcccgctgaag
gggcatgcgggctggtccgacatcgtccggctgcatgtctggaacggcgaactccacctg
catatcaagggcgcgcacggcgtcgtcgcgaccagcctggagcaggcggacggcttcgcc
ggttatcgcggcgctccggaagatcccacggcgatcctgctccgccataacggcctgcat
atcgaactggtcatcgaccgctcgcaccccattggcggcggcgatccggcgggcatcgcc
gacatcatcctggaatccgcgctcaccaccatctgcgacctggaggactcggtcgccgcc
gtcgacgcggatgacaaggtcgccgcctattccaactggctgggcctgatgcagggcaat
cttgtcgacacgttcgagaagaacggcgcgatgatgacccgcgccctcaaccccgaccgc
agctatatagcgcccaagggcggcgtcttcaccctgccgggccgcagcctgctgttcgtc
cgcaatgtcggccatctgatgaccacgcccgccgtcctgctggccgatggcgcgcaggcg
cccgaaggcatagtcgacggcatcgtcaccagcctgatcgccctgcacgacctgaagcgg
gcagggggcaacagccgcgccggcagcgtctatatcgtcaagcccaagatgcacgggccg
gaggaggtcggcttcaccaaccgcctgttcgacgccatagaggatcttctgggcctcgac
cgccacacgctcaaggtcggcgtgatggatgaggaacgccgcacctccgccaaccttgcc
gcctgcatcgcggcggtgaaggaccgcatcgtcttcatcaacaccggcttcctcgaccgc
acgggcgacgagatgcacacatcgatgcacgccggtcccatgatccgcaagggagagatg
aaggccagcgactggatcacggcctatgaggaccgcaatgtccagatcggcctcgcctgc
ggcctgtcgggccgcgcccagatcggcaagggcatgtgggccgcgccggaccgcatggcc
gacatgctggaccagaagatcggccacccgaagagcggcgccaacaccgcctgggttccg
tcccccacggcggcgacgctgcacgcgactcactatcacggcgtcaacgtcttagaacgt
caggatgatcgcgcgaaggaagccgtcgccccgctcgacaagctgctgacgatccccgtc
gcccagggccgcaactggtcggaggaggaaatcacgcaggaactggacaataatgcccag
ggcatattgggctatgtcgtccgctggatcgaccagggcgtcggctgctcgaaggttccc
gacatccacgacatcggcctgatggaagaccgcgccacgctgcgcatttcctctcagcat
atggcgaactggctgctccacggcgtctgcacggcggaacaggtcgacgccgccttcacc
cgcatggccgccaaggtcgacgcccagaatgcaggcgatccgctctatcggccgatgagc
ggccatccggaaagcctcgcctggcaagccgcccgcgccctggtcttcgaaggcgtcagc
caacccaatggctacaccgaacccctgctccacaaatatcgcgcactggcgaaggcgctc
taa

  All links  
No link information was found.   
DBGET integrated database retrieval system