KEGG   Sphingobium japonicum: SJA_C1-21960Help
Entry
SJA_C1-21960      CDS       T01201                                 

Gene name
glgB
Definition
1,4-alpha-glucan branching enzyme (EC:2.4.1.18)
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
sjp  Sphingobium japonicum
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Trehalose biosynthesis, D-glucose 1P => trehalose
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:sjp00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
1:complement(2199854..2202016)
Genome map
AA seq 720 aa AA seqDB search
MGLTPEQIARLLEGREDDPFATLGVHPAEKGFTACVFLPDAVSVEACRLDGRAVGALDRV
HPAGLFFGKVALRKRQPLRYRATYADGGEYALVDPYSFGPVLGPMDDYYFAEGSHARLFD
KMGAHLITHEGVAGTHFAVWAPNAARVSVVGDFNRWDGRRAPMRRRQDAGIWEIFLPEVG
VGSAYKYEIVGPDGKVLPLKADPFAFRSELRPATASIVAAVPAHDWGDERHRAYWERADP
RREAISVYEVHAGSWQRGEDGNFLSWDALAHRLIPYVVGMGFTHIEFLPISEYPYDPSWG
YQTTGLYAPTARFGDPEGFARFVDGAHRAGVGVILDWVPAHFPTDAHGLAHFDGTALYEH
ADPRKGFHPDWNTAIYNFGRREVAQYLVNNALFWAERYHVDGLRVDAVASMLYLDYSRKE
GEWIPNSQGGRENVEAVDFLRQMNKALYGTHAGVMTIAEESTSWPKVSHPVHEGGLGFGF
KWNMGFMHDTLRYLARDPVHRAHHHDDITFGLLYAFTENFVLALSHDEVVHGKASLLHKM
PGDDWQKFATLRAYYAMMWGYPGKKLLFMGQEFAQRAEWSEARALDWHLLDHAPHRGVQL
LVSDLNRLYRSHPALHARDCEPEGFEWVLVDAAADSVFAWVRRAPGLSPIVVISHFTPTL
RHGYRMRLPSGGRWREIVNSDAADYGGSGAGNMGIVTADEEGWANVTIPPLATLMLELDY
NT seq 2163 nt NT seq  +upstreamnt  +downstreamnt
gtgggcctgaccccggaacagatcgcccgcctgctggaggggcgggaggacgatccgttc
gcgacgcttggcgtccatccggcggaaaagggtttcaccgcctgcgtcttcctgcccgat
gcggtgagcgtcgaggcatgcaggctggacggcagggcggtcggcgcgctggatcgggtc
catccggcggggctgttcttcggcaaggtcgccctgcgcaagcgccagccgctgcgctat
cgggcgacctatgccgatggcggcgaatatgcgctggtcgatccctacagcttcggcccg
gtgctggggccgatggacgattattattttgccgaagggtctcatgcccggctattcgac
aagatgggcgcgcacctcatcacccatgaaggggtggcgggcacgcatttcgcggtctgg
gcgcccaacgcggcgcgggtgtcggtggtgggcgacttcaaccgctgggatggtcgccgg
gcgccgatgcggcggcggcaggatgcgggaatatgggaaatcttcctgcccgaagtgggg
gtgggcagcgcctataaatatgagatcgtcgggcctgacgggaaagtcctgccgctaaag
gccgaccccttcgcctttcgttccgaattgcggcccgcgacagcctccatcgtggcggcg
gtcccggcccatgactggggcgacgagcgccaccgcgcctattgggaaagggccgatccg
cgccgcgaagccatttccgtctatgaggtgcatgccggctcctggcagcgcggcgaggat
ggcaatttcctcagctgggacgcgctggcccaccggctgatcccctatgtggtcggcatg
ggcttcacccatatcgaattcctgccgatcagcgaatatccctatgatccaagctggggc
tatcagaccaccgggctttacgcgccgaccgcccgcttcggcgatccggagggctttgcc
cgcttcgtcgacggcgcgcaccgggcgggggtaggcgtcatcctcgactgggtgcctgcc
catttcccgaccgacgcccatgggctggcccatttcgacggcaccgccctttatgagcat
gccgatccgcgcaagggcttccaccccgactggaacaccgccatctataatttcggccgg
cgggaagtggcgcaatatctggtcaacaacgcccttttctgggcggagcgctaccatgtc
gacgggctgcgcgtcgacgccgtcgcctccatgctctacctcgactacagccgcaaggaa
ggggagtggattcccaacagccagggcgggcgggaaaatgtggaggcggtcgatttcctg
cggcagatgaacaaggcgctctacggcacccatgccggcgtcatgaccattgccgaggag
tcgacgagctggccgaaggtgtcccaccccgtccatgaaggcgggctgggcttcggtttc
aagtggaatatgggcttcatgcacgacacgctgcgctatctggcgcgcgatccagtgcac
cgcgcccatcatcatgacgacatcaccttcggcctgctctacgcctttacggagaatttc
gtgctggcgctcagccatgacgaggtggtgcacggcaaggcgtccctgctgcacaagatg
cccggcgacgactggcagaaattcgcgaccctgcgcgcctattacgccatgatgtggggc
tatccgggcaagaagctgctgttcatggggcaggaattcgcccagcgcgccgaatggagc
gaggcgcgggcgctagactggcacctgctcgatcacgcgccgcaccggggcgtgcagttg
ctggtgagcgacctcaaccgcctctaccgctcccatcccgccttgcatgcccgcgattgc
gagccggagggcttcgaatgggtgctggtcgacgcggcggcggactcggtcttcgcctgg
gtccggcgcgcgcccggcctgtcgcccatcgtcgtcatcagccacttcacgccgaccttg
cgccacggctaccgcatgcgcctgccctccggcggccgctggcgagagatcgtcaacagc
gacgccgccgactatggcggcagcggcgcgggcaatatggggatcgtcaccgccgatgag
gaaggatgggccaatgtcaccattccgccgctcgcgacgttgatgctggaactggactat
tga

DBGET integrated database retrieval system