KEGG   Sphingobium japonicum: SJA_C1-23060Help
Entry
SJA_C1-23060      CDS       T01201                                 

Definition
glutathione peroxidase (EC:1.11.1.9)
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
sjp  Sphingobium japonicum
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:sjp00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    SJA_C1-23060
  Metabolism of other amino acids
   00480 Glutathione metabolism
    SJA_C1-23060
Enzymes [BR:sjp01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     SJA_C1-23060
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
1:complement(2322401..2322940)
Genome map
AA seq 179 aa AA seqDB search
MIQQIPLKTIKGADASLADYAGKVVLVVNVASQCGLTPQYEGLEKLYRDYRDKGLVVAGF
PANDFGAQEPGSNEEIATFCTTHFGVDFPMFEKIVVAGPEKHPLYAALIGAQPNARGEGT
QFREKLVGYGITPNPEPEVLWNFEKFLIAKDGSVAARFAPSTAPDDAGLVAAIEAELAK
NT seq 540 nt NT seq  +upstreamnt  +downstreamnt
atgatccagcagattccgctcaagaccatcaagggcgccgacgccagcctggccgactat
gcgggcaaggtggtgctggtggtcaacgtcgcctcccaatgcggcctgaccccgcaatat
gaggggctggaaaagctctatcgcgactatagggacaaggggctggtcgtcgccggcttc
cccgccaatgatttcggcgcgcaggagccgggcagcaatgaggagatcgcgaccttctgc
accacccatttcggcgtcgacttcccgatgttcgagaagatcgtcgttgctgggcctgaa
aagcatccgctctacgccgcgctgatcggcgcgcagccaaatgcgcggggggagggcacc
cagttccgcgaaaagctggtcggctatggcatcacgcccaatccggagcccgaagtgctc
tggaatttcgaaaagttcctgatcgcgaaggacggcagcgtcgccgcccgctttgcaccc
tcgaccgcgcccgacgatgccggcctggtggcggcgatagaggcggaactggcgaaatag

DBGET integrated database retrieval system