KEGG   Sphingobium japonicum: SJA_C1-23060Help
Entry
SJA_C1-23060      CDS       T01201                                 

Definition
glutathione peroxidase (EC:1.11.1.9)
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
sjp  Sphingobium japonicum
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Class
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:sjp00590]
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:sjp00480]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
1:complement(2322401..2322940)
Genome map
AA seq 179 aa AA seqDB search
MIQQIPLKTIKGADASLADYAGKVVLVVNVASQCGLTPQYEGLEKLYRDYRDKGLVVAGF
PANDFGAQEPGSNEEIATFCTTHFGVDFPMFEKIVVAGPEKHPLYAALIGAQPNARGEGT
QFREKLVGYGITPNPEPEVLWNFEKFLIAKDGSVAARFAPSTAPDDAGLVAAIEAELAK
NT seq 540 nt NT seq  +upstreamnt  +downstreamnt
atgatccagcagattccgctcaagaccatcaagggcgccgacgccagcctggccgactat
gcgggcaaggtggtgctggtggtcaacgtcgcctcccaatgcggcctgaccccgcaatat
gaggggctggaaaagctctatcgcgactatagggacaaggggctggtcgtcgccggcttc
cccgccaatgatttcggcgcgcaggagccgggcagcaatgaggagatcgcgaccttctgc
accacccatttcggcgtcgacttcccgatgttcgagaagatcgtcgttgctgggcctgaa
aagcatccgctctacgccgcgctgatcggcgcgcagccaaatgcgcggggggagggcacc
cagttccgcgaaaagctggtcggctatggcatcacgcccaatccggagcccgaagtgctc
tggaatttcgaaaagttcctgatcgcgaaggacggcagcgtcgccgcccgctttgcaccc
tcgaccgcgcccgacgatgccggcctggtggcggcgatagaggcggaactggcgaaatag

DBGET integrated database retrieval system