KEGG   Sphingobium japonicum: SJA_C1-24310Help
Entry
SJA_C1-24310      CDS       T01201                                 

Gene name
sucB
Definition
2-oxoglutarate dehydrogenase E2 component (EC:2.3.1.61)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
sjp  Sphingobium japonicum
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Class
Metabolism; Overview; Carbon metabolism [PATH:sjp01200]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:sjp00020]
Metabolism; Amino acid metabolism; Lysine degradation [PATH:sjp00310]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
1:complement(2448701..2449939)
Genome map
AA seq 412 aa AA seqDB search
MATEVKVPTLGESVTEATVGQWLKKPGEAVKADEPIVSLETDKVAVDVPAPVAGVLGDIV
AKEGDTVEVGALLAYVNEGAAAAAAPAAAPAPAAKAEAAAPAPAASAPADDEEGGNLTLS
PAVRRLVLEHGLDPSKIKGTGKDGRLTKDDVVAAAAAGTAKAAASAPAAAPAAAPAAGPS
RAQERVKMTRLRQTVAKRLKEAQNNAALLTTYNDVDMTNVIEARAKYKDLFEKKHGVRLG
FMGFFTKAVCMALRDIPGVNAQIEGDEIVYNDFADISVAVSAPNGLVVPVIRNAESLSVA
DIEKTIGNFGKKAKEGTLTMEDMKGGTFTISNGGVFGSLLSSPIINPPQSAVLGLHRIED
RPVVRNGQIVIRPMMYLALSYDHRLIDGREAVTFLVAVKNAIEDPTRLLIDL
NT seq 1239 nt NT seq  +upstreamnt  +downstreamnt
atggctaccgaagtcaaagtccctactctgggcgaatccgttaccgaagcaaccgttggc
cagtggctgaagaagcccggcgaggcggtgaaggccgacgagcccatcgtctcccttgaa
accgacaaggtcgcggtcgacgtgcccgcgccggtcgccggcgtgctgggcgacatcgtc
gccaaggaaggcgacacggtcgaggtcggcgcgctgctggcctatgtgaacgaaggcgcg
gccgccgcggccgctcccgccgctgctcccgcccccgccgccaaggcggaggcggccgcc
ccggctcccgccgcttcggctccggccgatgacgaggaaggcggcaacctgaccctgtcg
ccggcggtccgccgcctggtgctggaacatggcctggaccccagcaagatcaagggcacg
ggcaaggacggccgcctgaccaaggacgatgtcgttgccgctgccgccgcgggcaccgcc
aaggccgccgcttcggccccggccgccgctcccgccgccgctcccgccgccggtcccagc
cgcgcgcaggaacgcgtcaagatgacccgcctgcgccagaccgtcgccaagcggctcaag
gaagcgcagaacaacgcggcgctgctcaccacctataatgacgtggacatgaccaacgtc
atcgaggcgcgggcgaagtacaaggacctgttcgagaagaagcatggcgtccgcctgggc
ttcatgggcttcttcaccaaggccgtctgcatggcgctgcgcgacattccgggcgtcaac
gcgcagatcgagggcgacgagatcgtctataacgacttcgccgacatctcggtcgcggtg
tcggccccgaacggcctggtcgtgccggtcatccgcaacgcggaatcgctgagcgttgcc
gatattgaaaagaccatcggcaatttcgggaagaaggccaaggaaggcacgctgaccatg
gaggatatgaagggcggcaccttcaccatctccaatggcggcgtcttcggctcgctgctg
tctagcccgatcatcaacccgccgcagtcggcggtgctgggcctgcaccggatcgaggac
cgtccggtcgtccgcaacggccagatcgtcatccgcccgatgatgtatctcgccctcagc
tacgaccatcgcctgatcgacggtcgcgaggcggtgactttcctggtcgcggtgaagaac
gcgatcgaggatccgacccgcctgctgatcgacctgtaa

DBGET integrated database retrieval system