KEGG   Sphingobium japonicum: SJA_C1-24440Help
Entry
SJA_C1-24440      CDS       T01201                                 

Gene name
pldB
Definition
lysophospholipase (EC:3.1.1.5)
Orthology
K01048  
lysophospholipase [EC:3.1.1.5]
Organism
sjp  Sphingobium japonicum
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:sjp00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    SJA_C1-24440 (pldB)
Enzymes [BR:sjp01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     SJA_C1-24440 (pldB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
1:complement(2463543..2464523)
Genome map
AA seq 326 aa AA seqDB search
MRRMDSPRFVPAPFDRRAWPMDGRLDYWTAPDGWGLRRYRLGEGGRGRMLVLGGRGDMIE
KYLEVIRHWADRGWAVTGFDWRGQGGSGRTTADPLCGHIDDFGQWIADLDAFAADWRGQG
EGPSAIVAHSMGGHLLLRALAEGMAPPDAAVTVAPMMGLRTAPLPRWLAVAIAEAMCALG
FAEKQAWTQKEESERQRRMRQKRLTHDPERYADELWWRDHGREVALGPPSWKWVAQALHS
TRALEKGGAIERIAVPLLILAARTDRLVSTPAIERIAARIAGARLHVYGREAAHEILREL
DPVRLDALARIDRFLDEVAPNRIGAG
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atgcggcgcatggattcgccccgcttcgttcccgctcccttcgaccggcgcgcctggccg
atggacgggcggctcgattactggaccgcgcccgacggctggggcctgcgccgctaccgg
ctgggcgagggcggtcgcggcaggatgctggtgctgggcggacgcggcgacatgatcgag
aaatatcttgaggtcatccgccactgggccgaccggggatgggcggtcaccggcttcgac
tggcgcggtcagggcggatcgggccgcacgaccgctgatccgctgtgcgggcatatcgac
gatttcgggcaatggatcgccgacctggatgccttcgccgccgattggcgcggtcagggg
gaggggccgagcgcgatcgtcgcgcacagcatgggcggccacctgctgctgcgcgcgctg
gcggaggggatggcgccgcccgacgcggccgtgaccgtcgcgccgatgatgggcctgcgc
accgcgccgctgccccgctggctggcggtggccattgccgaagcgatgtgcgcgctgggc
tttgccgaaaaacaggcctggacgcagaaggaggagtcggaacggcagcgccgcatgcgg
cagaagcggctgacccacgatcccgaacgctatgccgatgaactgtggtggcgcgaccat
gggcgggaggtggcgctggggccgcctagctggaaatgggtggcgcaggcgctgcattcg
acccgcgcgctggaaaagggaggggcgatcgagcggatcgcggtgcccttgctcatactc
gcggcgcggacggaccggctggtctccacgcccgccatcgagcggatcgcggcgcggatc
gccggcgcgcggctgcatgtctacgggcgcgaggcggcgcatgagatattgcgggaactg
gacccggtgcggctggacgcgctggcgcgcatcgaccgcttcctggatgaagtcgccccg
aaccggatcggcgcgggatga

DBGET integrated database retrieval system