KEGG   Sphingobium japonicum: SJA_C1-24540Help
Entry
SJA_C1-24540      CDS       T01201                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
sjp  Sphingobium japonicum
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:sjp03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
1:complement(2473004..2473600)
Genome map
AA seq 198 aa AA seqDB search
MASPEIEELTQALSRLPGLGPRSARRAVLHLLKKRESALEPLLRALDAVNERLVTCSLCG
NVDTVDPCGICADPRRDARALCVVEDVADLWALDKSRLFPGRFHVLGGRLSALEGVRPED
LSIDALVARVEAGGIDEVVLAMNATLEGQTTAHYLAERLERFPVRLTQLAHGVPVGGELD
YLDEGTLAQALRARRPLG
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atggcttctccagagatcgaagagctgacgcaggcgctgtcccgcctgcccggccttggc
ccgcgttcggcgcggcgcgccgtgctgcacctgctcaagaagcgggaatccgcgctggag
ccgctgctgcgcgccctggacgcggtgaacgagcggctggtgacgtgcagcctgtgcggc
aatgtcgacaccgtcgatccctgcggcatctgcgccgatccgcgccgggatgcgcgggcg
ctctgcgtcgtggaggatgtggcggacctctgggcgctcgacaagtcgcggctgtttccg
ggccgcttccatgtgctgggcggccggctgtcggcgctggagggcgtgcggccggaggat
ctgtccatcgatgcgctggtggcgcgggtggaggcgggcggcatagacgaggtggtgctg
gcgatgaacgcgacgctggagggacagaccaccgcccattatctggccgaacggctggag
cgctttcccgtgcgcctgacgcaactggcgcatggcgtgcccgttggcggcgaactggac
tatctggacgagggcacgttggcgcaggcgcttcgggcgcggcggccgctggggtga

DBGET integrated database retrieval system