KEGG   Sphingobium japonicum: SJA_C1-24540Help
Entry
SJA_C1-24540      CDS       T01201                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
sjp  Sphingobium japonicum
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:sjp00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    SJA_C1-24540 (recR)
DNA repair and recombination proteins [BR:sjp03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      SJA_C1-24540 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
1:complement(2473004..2473600)
Genome map
AA seq 198 aa AA seqDB search
MASPEIEELTQALSRLPGLGPRSARRAVLHLLKKRESALEPLLRALDAVNERLVTCSLCG
NVDTVDPCGICADPRRDARALCVVEDVADLWALDKSRLFPGRFHVLGGRLSALEGVRPED
LSIDALVARVEAGGIDEVVLAMNATLEGQTTAHYLAERLERFPVRLTQLAHGVPVGGELD
YLDEGTLAQALRARRPLG
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atggcttctccagagatcgaagagctgacgcaggcgctgtcccgcctgcccggccttggc
ccgcgttcggcgcggcgcgccgtgctgcacctgctcaagaagcgggaatccgcgctggag
ccgctgctgcgcgccctggacgcggtgaacgagcggctggtgacgtgcagcctgtgcggc
aatgtcgacaccgtcgatccctgcggcatctgcgccgatccgcgccgggatgcgcgggcg
ctctgcgtcgtggaggatgtggcggacctctgggcgctcgacaagtcgcggctgtttccg
ggccgcttccatgtgctgggcggccggctgtcggcgctggagggcgtgcggccggaggat
ctgtccatcgatgcgctggtggcgcgggtggaggcgggcggcatagacgaggtggtgctg
gcgatgaacgcgacgctggagggacagaccaccgcccattatctggccgaacggctggag
cgctttcccgtgcgcctgacgcaactggcgcatggcgtgcccgttggcggcgaactggac
tatctggacgagggcacgttggcgcaggcgcttcgggcgcggcggccgctggggtga

DBGET integrated database retrieval system