KEGG   Sphingobium japonicum: SJA_C1-25100Help
Entry
SJA_C1-25100      CDS       T01201                                 

Gene name
pcm
Definition
protein-L-isoaspartate(D-aspartate) O-methyltransferase
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
sjp  Sphingobium japonicum
Brite
Enzymes [BR:sjp01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     SJA_C1-25100 (pcm)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
1:complement(2529249..2529881)
Genome map
AA seq 210 aa AA seqDB search
MTEQNFSSMRAAMVESQLRTSDVDDQRVIAAMAHVAREEFVPAERRAMAYVDRPVPLAGG
RALNPPLVTGRLLKEAQIAKGDKVLLIGAATGYSAALLARLGAQVTAVEEEGGPEIAVDG
VAVVRGPLNAGSAADAPYDVLFIDGAVEEVPAALVQQLADGARVVTGIVERGVTRLCSGR
VVSGVLGLSRLADMEMVVLPGFAAPEGFVF
NT seq 633 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgagcagaatttttcatcgatgcgggccgccatggtcgaaagccagcttcgcacc
agcgatgtggacgatcagcgcgtgatcgcggcgatggcgcatgtggcgcgcgaggaattc
gtgccggccgagcggcgggcgatggcctatgtcgaccggccggtcccgctcgccggcggg
cgcgcgctcaatccgccgctggtgacgggccgcctgctcaaggaggcgcagatcgccaag
ggcgacaaggtgctgctgatcggcgccgccaccggctacagcgcggcgctgctcgcaagg
ctgggcgctcaggtcaccgcggtcgaggaagagggcgggccggagatcgcggtagacggc
gtggcggtggttcgcggtccgctgaacgccggttccgccgccgatgcgccctatgatgtg
ctgtttatcgacggcgcagtggaggaagtgcccgccgcgctcgttcagcagcttgccgat
ggcgcgcgggtggtgacgggtatcgtggagcgcggcgtcacccgcctgtgcagcggtcgg
gtggtgtcgggcgtgctgggtctttcccgcctcgccgacatggaaatggttgtgcttccg
ggctttgccgcgccggaaggatttgtgttctga

DBGET integrated database retrieval system