KEGG   Sphingobium japonicum: SJA_C1-25180Help
Entry
SJA_C1-25180      CDS       T01201                                 

Gene name
catA_pcaH
Definition
catechol 1,2-dioxygenase (EC:1.13.11.1 1.13.11.3)
Orthology
K03381  
catechol 1,2-dioxygenase [EC:1.13.11.1]
Organism
sjp  Sphingobium japonicum
Pathway
Chlorocyclohexane and chlorobenzene degradation
Benzoate degradation
Fluorobenzoate degradation
Toluene degradation
Metabolic pathways
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Module
Catechol ortho-cleavage, catechol => 3-oxoadipate
Class
Metabolism; Overview; Degradation of aromatic compounds [PATH:sjp01220]
Metabolism; Xenobiotics biodegradation and metabolism; Benzoate degradation [PATH:sjp00362]
Metabolism; Xenobiotics biodegradation and metabolism; Fluorobenzoate degradation [PATH:sjp00364]
Metabolism; Xenobiotics biodegradation and metabolism; Chlorocyclohexane and chlorobenzene degradation [PATH:sjp00361]
Metabolism; Xenobiotics biodegradation and metabolism; Toluene degradation [PATH:sjp00623]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
1:complement(2537316..2538206)
Genome map
AA seq 296 aa AA seqDB search
MTPDFVKTAPIQTLLDRASGMNAEGGDDRLKAIVRDLIEAVMVAIVKHDISESEFWQAVT
FLQQGAGEFGLIVPGAGIEHFLDLYMDAKDSEVGLSGGTPRTIEGPLYVEGAPLVEGEAN
LSDDADDTDTLHMSGFVTGPDGEPVQNAVVHVWHANSQGWYSHFDPTREQTPFNNRRRIR
LGADGRYAFHSKMPNGYSVPPGGATDRLMKAIGRHGNRPAHVHFFVEAPGYRTLTTQINF
GDDPFAADDFAFGTREGLLPVPDRRDKSAFIAFDFQLQRAASKEDENFSTRARAKA
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
atgacacccgatttcgtgaagaccgctcccatccagaccttgctggaccgcgccagcggc
atgaatgccgaagggggcgatgaccgcctgaaagccatcgtccgcgatctgatcgaggcc
gtgatggtcgccatcgtgaagcacgacatctccgaaagcgagttctggcaggctgtcacc
ttccttcagcagggcgcgggagaattcgggctgatcgttcccggtgcgggcatcgaacat
ttcctcgacctctacatggacgccaaggatagcgaggtcggcttatcgggcggcacgccg
cgcaccatagagggcccgctctatgtggagggcgcgccgctcgtcgaaggcgaggcgaac
ctttcggacgatgctgacgatacggacacgctccacatgtccggcttcgtgacggggccg
gatggcgagcccgtccagaacgccgtcgtccatgtctggcacgccaacagccagggctgg
tattcgcatttcgatcccacgcgcgagcagactccgttcaacaaccgccgccgcatcagg
ctgggcgccgatggccgctacgcctttcattccaagatgcccaatggctacagcgttcct
cctggaggggcgaccgacaggcttatgaaggcgatcggccgccacggcaatcgcccggca
catgtgcatttcttcgtcgaagcgccgggttatcggacgctgaccacccagatcaacttt
ggcgacgatccctttgccgcggacgatttcgccttcggcacgcgtgaaggcctgctgccg
gttcccgatcgtcgggacaagagcgcctttatcgcctttgatttccaactccagcgcgca
gcgtcgaaggaagacgaaaacttctccacgcgcgcccgcgccaaggcctga

DBGET integrated database retrieval system