KEGG   Sphingobium japonicum: SJA_C1-25180Help
Entry
SJA_C1-25180      CDS       T01201                                 

Gene name
catA_pcaH
Definition
catechol 1,2-dioxygenase (EC:1.13.11.1 1.13.11.3)
Orthology
K03381  
catechol 1,2-dioxygenase [EC:1.13.11.1]
Organism
sjp  Sphingobium japonicum
Pathway
Chlorocyclohexane and chlorobenzene degradation
Benzoate degradation
Fluorobenzoate degradation
Toluene degradation
Metabolic pathways
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Module
Catechol ortho-cleavage, catechol => 3-oxoadipate
Brite
KEGG Orthology (KO) [BR:sjp00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    SJA_C1-25180 (catA_pcaH)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    SJA_C1-25180 (catA_pcaH)
   00364 Fluorobenzoate degradation
    SJA_C1-25180 (catA_pcaH)
   00361 Chlorocyclohexane and chlorobenzene degradation
    SJA_C1-25180 (catA_pcaH)
   00623 Toluene degradation
    SJA_C1-25180 (catA_pcaH)
Enzymes [BR:sjp01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.1  catechol 1,2-dioxygenase
     SJA_C1-25180 (catA_pcaH)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
1:complement(2537316..2538206)
Genome map
AA seq 296 aa AA seqDB search
MTPDFVKTAPIQTLLDRASGMNAEGGDDRLKAIVRDLIEAVMVAIVKHDISESEFWQAVT
FLQQGAGEFGLIVPGAGIEHFLDLYMDAKDSEVGLSGGTPRTIEGPLYVEGAPLVEGEAN
LSDDADDTDTLHMSGFVTGPDGEPVQNAVVHVWHANSQGWYSHFDPTREQTPFNNRRRIR
LGADGRYAFHSKMPNGYSVPPGGATDRLMKAIGRHGNRPAHVHFFVEAPGYRTLTTQINF
GDDPFAADDFAFGTREGLLPVPDRRDKSAFIAFDFQLQRAASKEDENFSTRARAKA
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
atgacacccgatttcgtgaagaccgctcccatccagaccttgctggaccgcgccagcggc
atgaatgccgaagggggcgatgaccgcctgaaagccatcgtccgcgatctgatcgaggcc
gtgatggtcgccatcgtgaagcacgacatctccgaaagcgagttctggcaggctgtcacc
ttccttcagcagggcgcgggagaattcgggctgatcgttcccggtgcgggcatcgaacat
ttcctcgacctctacatggacgccaaggatagcgaggtcggcttatcgggcggcacgccg
cgcaccatagagggcccgctctatgtggagggcgcgccgctcgtcgaaggcgaggcgaac
ctttcggacgatgctgacgatacggacacgctccacatgtccggcttcgtgacggggccg
gatggcgagcccgtccagaacgccgtcgtccatgtctggcacgccaacagccagggctgg
tattcgcatttcgatcccacgcgcgagcagactccgttcaacaaccgccgccgcatcagg
ctgggcgccgatggccgctacgcctttcattccaagatgcccaatggctacagcgttcct
cctggaggggcgaccgacaggcttatgaaggcgatcggccgccacggcaatcgcccggca
catgtgcatttcttcgtcgaagcgccgggttatcggacgctgaccacccagatcaacttt
ggcgacgatccctttgccgcggacgatttcgccttcggcacgcgtgaaggcctgctgccg
gttcccgatcgtcgggacaagagcgcctttatcgcctttgatttccaactccagcgcgca
gcgtcgaaggaagacgaaaacttctccacgcgcgcccgcgccaaggcctga

DBGET integrated database retrieval system