KEGG   Sphingobium japonicum: SJA_C1-25920Help
Entry
SJA_C1-25920      CDS       T01201                                 

Definition
putative thymidine phosphorylase (EC:2.4.2.4)
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
sjp  Sphingobium japonicum
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sjp00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    SJA_C1-25920
Enzymes [BR:sjp01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     SJA_C1-25920
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
1:2612068..2613555
Genome map
AA seq 495 aa AA seqDB search
MLTIKRLAIDTYPENTAFMLRESNGYSAEQFQALRKIRVSDGRAEILATLALVDEPALLK
RGEIGLGEQAFRRLALPEGASVAIEQAMPPPSLEFVRRKIDGDTLQDDEVSAIIRDIAAH
RYSPMEIGAFLVACAGFMSTQETLAVTRAMADVGNRLDWRAPLVVDKHCIGGIPGNRTSM
IVVPIVAAHGLIMPKTSSRAITSPSGTADTMEVLASVDLSEEAMRAIVAKEKAVLAWGGK
VNLSPADDVLISVERPLRIDTFDQMVASILSKKLAAGSTHLVLDIPLGPTAKVRTQDDAV
RLRKLFEHVADKIGLVIDIVVTDGSQPIGRGVGPVLEARDVMAVLRNDADAPQDLREHAL
FLAGRVLDFDPALRGGRGYARALDLLASGKALAAMERLIEAQGRQPVKFALGEHVHEVLA
TQEGRVGAIDCHRIARIARLAGAPMDKGAGIDLLHKVGAQVRKGQALYRIHAQSRTGLGF
ARDLAAEDSGYEMAG
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atgctgacgatcaagcgcctcgccatcgacacctatccggaaaacaccgccttcatgctg
cgcgaaagcaacggctattcggccgagcaatttcaggcgctgcgcaagatccgcgtcagt
gacggcagggccgaaatcctcgccacccttgcgctggtggacgaaccggcattgctgaag
cggggcgaaatcggtctgggcgagcaggccttccgtcgacttgccctgcccgaaggagcc
tcggtcgcgatcgaacaggcgatgccgccccccagcctggaattcgtccggcgcaagatc
gacggcgacacgcttcaggatgacgaagtgtccgcgatcatccgcgacattgccgcccac
cgctattctccgatggaaatcggcgccttcctggtcgcctgcgccggtttcatgagcacg
caggaaaccctcgccgtcactcgcgccatggccgacgttggcaatcgcttggattggaga
gcaccgctcgtcgtcgacaaacattgcatcggcgggatccccggcaaccgcacgtcgatg
atcgtggtgccgatcgtggcggcgcacggcctcatcatgcccaagacatcgtcgcgggcg
ataacctccccgtccggcaccgccgacacgatggaggtgctggcgagcgtcgacctcagc
gaggaggcgatgcgcgcgatcgtcgcgaaggaaaaggccgtgctcgcctggggcggcaag
gtgaacctgtcacccgccgacgatgtgctgatctccgtcgaacgcccgctgcggatcgac
acattcgatcagatggtcgcctccatcctctcgaaaaagctcgcggcgggttccacccat
ctggtgctcgacataccccttggccccaccgccaaggtgcgcacgcaggatgacgccgtt
cgcctgcgcaagctgttcgaacatgtcgcggacaagatcggcctcgtcatcgacatcgtc
gtcactgacggatcgcagcccatcggccgcggcgtcggccctgtgctggaggcgcgcgat
gtcatggcggtgctgcgcaacgatgccgacgcgccgcaggacttgcgcgaacatgcgctg
ttcctggcgggccgcgtcctcgacttcgatcccgccctgcgcggcggcaggggctatgca
cgggcgctggacctgctcgcctccggcaaggcgctcgccgccatggaacggctgatagaa
gcgcaggggcggcagcctgtgaagttcgcccttggcgaacatgtccatgaagtgctcgcc
acgcaggaggggcgggtgggcgccatcgactgccatcgcattgcgcgcatcgcccgcctc
gccggtgcgccgatggacaagggcgcgggcatcgacctgttgcacaaggtcggcgcgcag
gtgcgaaaggggcaggcgctctaccgcatccacgcccagtcgcgcaccggcctcggcttc
gcgcgggacctggcggcggaagactccggctatgagatggccgggtga

DBGET integrated database retrieval system