KEGG   Sphingobium japonicum: SJA_C1-27100Help
Entry
SJA_C1-27100      CDS       T01201                                 

Gene name
pyrB
Definition
aspartate carbamoyltransferase catalytic chain (EC:2.1.3.2)
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
sjp  Sphingobium japonicum
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sjp00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    SJA_C1-27100 (pyrB)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    SJA_C1-27100 (pyrB)
Enzymes [BR:sjp01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     SJA_C1-27100 (pyrB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
1:2717945..2718940
Genome map
AA seq 331 aa AA seqDB search
MPDITVPSAQSDLTGRALFPHRHLLSIADLKPWEIRFLLDEAEHWAKSNRGGARKHDDRL
AGMTQINAFFENSTRTLLSFEIAGKRLGADVVNMAAATSSVKKGETLIDTAMTLNAMAAD
VIVIRHASSGAVALIADKVDCPVLNAGDGWHQHPTQALLDALTIRRRKGGFEGLVVAICG
DVLHSRVARSNMLCLAALGAQVRAVAPPTLMPPEVEMLGATPYSRMDEGLDGADVVMMLR
LQNERMDGAFIPSPREYHMLYGLTPERLAIAKPDALVMHPGPMNRGVEIASVVADHPDRS
AITEQVEMGVAIRMACLDVLTRGARGVEGWA
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
atgcccgacatcaccgttccatccgcccagtccgacctgaccggccgggcgttgtttccg
caccggcatctcctgtccatcgccgacctcaagccctgggaaatccgcttcctcctcgat
gaggcggaacattgggcaaaaagcaaccggggcggcgcgcgcaagcatgacgaccgcctg
gcgggcatgacccagatcaacgccttcttcgaaaacagcacccgcaccctcctctccttc
gagatcgcgggcaagcggctgggcgcggacgtcgtcaacatggccgccgccacctccagc
gtgaagaagggcgagacgctgatcgacaccgccatgacgctgaacgccatggccgccgac
gtgatcgtcatccgccacgccagttccggcgcggtggcgctgatcgcggacaaggtcgat
tgcccggtgctgaacgcgggcgacggctggcaccagcatccgacccaggccctgctcgac
gcgctcaccatccgccgccgcaagggcgggttcgaagggctggtcgtcgccatctgcggc
gacgtgctgcacagccgggtggcgcgctcgaacatgctctgcctcgccgccctgggcgcg
caggtccgcgccgtcgccccgcccacgctgatgccgcccgaagtcgagatgctgggcgcg
accccctatagccgcatggacgaggggctggacggcgccgacgtggtgatgatgctgcgc
ctccagaatgagcggatggacggggccttcatcccctccccccgcgaatatcacatgctc
tacggcctgaccccggaacggctcgccatcgccaagcccgacgcgctggtcatgcacccc
ggcccgatgaaccggggggtggagatcgccagcgtcgtcgccgatcacccggaccgctcc
gccatcaccgagcaggtggaaatgggcgtcgccatccgcatggcctgcctcgacgtcctg
accagaggcgcgcgcggcgtggagggctgggcatga

DBGET integrated database retrieval system