KEGG   Sphingobium japonicum: SJA_C1-27100Help
Entry
SJA_C1-27100      CDS       T01201                                 

Gene name
pyrB
Definition
(GenBank) aspartate carbamoyltransferase catalytic chain
  KO
K00609  aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
sjp  Sphingobium japonicum
Pathway
sjp00240  Pyrimidine metabolism
sjp00250  Alanine, aspartate and glutamate metabolism
sjp01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sjp00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    SJA_C1-27100 (pyrB)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    SJA_C1-27100 (pyrB)
Enzymes [BR:sjp01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     SJA_C1-27100 (pyrB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OTCace_N OTCace
Motif
Other DBs
NCBI-ProteinID: BAI97544
NITE: SJA_C1-27100
UniProt: D4Z4L2
Position
1:2717945..2718940
Genome map
AA seq 331 aa AA seqDB search
MPDITVPSAQSDLTGRALFPHRHLLSIADLKPWEIRFLLDEAEHWAKSNRGGARKHDDRL
AGMTQINAFFENSTRTLLSFEIAGKRLGADVVNMAAATSSVKKGETLIDTAMTLNAMAAD
VIVIRHASSGAVALIADKVDCPVLNAGDGWHQHPTQALLDALTIRRRKGGFEGLVVAICG
DVLHSRVARSNMLCLAALGAQVRAVAPPTLMPPEVEMLGATPYSRMDEGLDGADVVMMLR
LQNERMDGAFIPSPREYHMLYGLTPERLAIAKPDALVMHPGPMNRGVEIASVVADHPDRS
AITEQVEMGVAIRMACLDVLTRGARGVEGWA
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
atgcccgacatcaccgttccatccgcccagtccgacctgaccggccgggcgttgtttccg
caccggcatctcctgtccatcgccgacctcaagccctgggaaatccgcttcctcctcgat
gaggcggaacattgggcaaaaagcaaccggggcggcgcgcgcaagcatgacgaccgcctg
gcgggcatgacccagatcaacgccttcttcgaaaacagcacccgcaccctcctctccttc
gagatcgcgggcaagcggctgggcgcggacgtcgtcaacatggccgccgccacctccagc
gtgaagaagggcgagacgctgatcgacaccgccatgacgctgaacgccatggccgccgac
gtgatcgtcatccgccacgccagttccggcgcggtggcgctgatcgcggacaaggtcgat
tgcccggtgctgaacgcgggcgacggctggcaccagcatccgacccaggccctgctcgac
gcgctcaccatccgccgccgcaagggcgggttcgaagggctggtcgtcgccatctgcggc
gacgtgctgcacagccgggtggcgcgctcgaacatgctctgcctcgccgccctgggcgcg
caggtccgcgccgtcgccccgcccacgctgatgccgcccgaagtcgagatgctgggcgcg
accccctatagccgcatggacgaggggctggacggcgccgacgtggtgatgatgctgcgc
ctccagaatgagcggatggacggggccttcatcccctccccccgcgaatatcacatgctc
tacggcctgaccccggaacggctcgccatcgccaagcccgacgcgctggtcatgcacccc
ggcccgatgaaccggggggtggagatcgccagcgtcgtcgccgatcacccggaccgctcc
gccatcaccgagcaggtggaaatgggcgtcgccatccgcatggcctgcctcgacgtcctg
accagaggcgcgcgcggcgtggagggctgggcatga

DBGET integrated database retrieval system