KEGG   Sphingobium japonicum: SJA_C1-28130Help
Entry
SJA_C1-28130      CDS       T01201                                 

Definition
beta-N-acetylhexosaminidase (EC:3.2.1.52)
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
sjp  Sphingobium japonicum
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sjp00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    SJA_C1-28130
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    SJA_C1-28130
Enzymes [BR:sjp01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     SJA_C1-28130
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
1:complement(2815047..2816060)
Genome map
AA seq 337 aa AA seqDB search
MKPVIFGLSGETLTSDERAFFADADPAGYILFRRNIVDRAQLRALTDDLRALHGRGDLLI
MIDQEGGRVARMQAPVWPSFPPGAAFDRLYEIAPSSAIAAARANARAIAATLAEVGITVD
ALPLLDVRQEGASDIMGDRTLGAEPMRVAALGRAVIEGLADGGVVGIVKHMPGHGRAMVD
SHHELPIVTADEDALAIDLAPFQALKDVPMGMTAHVVYTAWDPDLPASLSPSVIETIIRG
RIGFDGLLMSDDLDMKALKGSIPELAAATVAAGCDLALNCWGRMDDMAGIAGLLPDIGAA
AKARLDRAMASRRTLPDGPPLEELIATRDALLAMAPA
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atgaaacccgttatcttcggcctttccggcgagaccctgacttccgacgaacgcgccttc
ttcgcggacgccgatccggcgggttacatcctcttccggcgcaatatcgtggatcgggcg
cagcttcgcgccctgaccgacgatctgcgcgccttgcatggccgcggcgatctgctcatc
atgatcgaccaggaaggcggccgggtggcgcggatgcaggcgcctgtctggcccagcttt
ccccccggcgcggcgttcgaccggctctatgaaatcgccccgtccagcgccatcgcggcc
gcccgcgccaatgcgcgggccattgccgcgacattggcggaagtcggcatcaccgtggac
gcgcttccgctgctggacgtgcggcaggaaggggcgagcgacatcatgggagaccggacg
ctgggcgcggagccgatgcgggtcgcggccttggggcgggccgtgatcgaagggctggcc
gacggcggcgtggtcggcatcgtcaagcatatgccgggccatggccgggcgatggtcgac
agccatcacgaactgcccatcgtcaccgccgacgaggatgcgctggcgatcgacctcgcg
ccgttccaggcgttgaaggacgtgcccatggggatgaccgcgcatgtcgtctataccgcc
tgggatcccgacctgccggccagcctatccccttccgtgatcgagacgatcattcgcggt
cggatcggtttcgacgggctgctgatgtccgacgacctcgacatgaaggcgctcaagggc
agcatccccgaactggcggcggcgacggtcgcggcgggttgcgacctggcgctcaactgc
tggggacggatggacgacatggccggcattgccggccttctgccggacatcggggcggcg
gcgaaggcacggctggaccgggcgatggcgtcgaggcgcaccctgccggacggcccgccg
ctggaggaactgatcgccacccgcgacgccctgctggcgatggcgccggcatga

DBGET integrated database retrieval system