KEGG   Sphingobium japonicum: SJA_C1-28310Help
Entry
SJA_C1-28310      CDS       T01201                                 

Gene name
aceA
Definition
(GenBank) isocitrate lyase
  KO
K01637  isocitrate lyase [EC:4.1.3.1]
Organism
sjp  Sphingobium japonicum
Pathway
sjp00630  Glyoxylate and dicarboxylate metabolism
sjp01100  Metabolic pathways
sjp01110  Biosynthesis of secondary metabolites
sjp01120  Microbial metabolism in diverse environments
sjp01200  Carbon metabolism
Module
sjp_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:sjp00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    SJA_C1-28310 (aceA)
Enzymes [BR:sjp01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     SJA_C1-28310 (aceA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ICL PEP_mutase Lipase_GDSL_2
Motif
Other DBs
NCBI-ProteinID: BAI97665
NITE: SJA_C1-28310
UniProt: D4Z4Y3
Position
1:complement(2830370..2831962)
Genome map
AA seq 530 aa AA seqDB search
MTYSQEITKAGATIGGQGHWDGIAAESVARMRLQNRFHTGLDIARYTAGIMRRDMAAYDA
DPANYTQSLGCWHGFIGQQKMISIKKHFGTTKGRYLYLSGWMVAALRSEFGPLPDQSMHE
KTSVPALIEELYTFLKQADARELGMMFRDLDAAREAGDEVKAQKIQQDIDNYETHVVPIV
ADIDAGFGNAEATYLLAKKFIEAGACCIQIENQVSDEKQCGHQDGKVTVPHEDFLAKIRA
VRYAFLELGVDDGIIVARTDSLGAGLTKQIAYSKEDGDLGDQYNSFLDVEEVTDITTLRG
DVVLARDGKLFRPKRLPSNLFQFRAGTGEDRVVLDCITSLQNGADLLWIETEKPHVEQIA
GMVDRIREVVPNAKLVYNNSPSFNWTLNFRQQVFDRWTAEGKDVSAYDRAKLMSADYDAT
ELGLEADEKIRTFQKDAAARAGIFHHLITLPTYHTAALSTDNLAKEYFGEAGMLGYVAGV
QRKEIRQGIACVKHQNMSGSDIGDDHKEYFAGEAALKAGGIHNTMNQFAA
NT seq 1593 nt NT seq  +upstreamnt  +downstreamnt
atgacctacagccaggaaatcacgaaagcgggcgccaccatcggcgggcaaggccattgg
gatggcatcgccgccgaatcggtcgcccggatgcgcctccagaaccgttttcacaccggc
ctcgacatcgcccgctacaccgcggggatcatgcgccgcgacatggccgcctatgatgcc
gacccggccaactacacccagtcgctgggctgctggcacggcttcatcggccagcagaag
atgatcagcatcaaaaagcatttcggcaccaccaagggccgttatctctacctctccggc
tggatggtcgccgccctgcgcagcgaattcggcccgctgcctgaccagtcgatgcatgaa
aagaccagcgtccccgcgctgatcgaggaactctacaccttcctgaagcaggccgacgcc
cgcgaactggggatgatgttccgcgacctcgacgccgcccgcgaagccggcgacgaagtc
aaggcgcagaagatccagcaggacatcgacaattacgaaacccacgtcgtccccatcgtc
gcggacatcgacgcgggcttcggcaatgccgaggcgacctacctgcttgccaagaagttc
atcgaagcgggcgcctgctgcatccagatcgaaaaccaggtctcggacgaaaagcagtgc
ggccaccaggacggcaaggtcacggttccgcatgaggatttcctcgcgaagatccgcgcc
gtccgctacgccttcttggaactcggcgtcgacgacggcatcatcgtcgcccgcaccgac
tcgctgggcgctggcctcaccaagcagattgcctacagcaaggaagatggcgacctgggc
gaccagtataacagcttcctcgacgtcgaagaggtcaccgacatcaccaccctgcgcggc
gatgtcgtcctggcccgcgacggcaagctgttccgtcccaagcgcctgccgtcgaacctg
ttccagttccgcgccggcaccggcgaagaccgcgtcgtcctcgactgcatcacctcgctc
cagaacggcgcggacctgctgtggatcgaaaccgaaaagccgcatgtcgagcagatcgcg
ggcatggtcgaccgcatccgcgaagtcgtccccaatgcgaagctggtctacaacaactcg
cccagcttcaactggacgctgaacttccgccagcaggtgttcgaccgctggaccgccgag
ggcaaggatgtcagcgcctatgaccgggcgaagctgatgagcgccgattacgacgcgacc
gaactgggccttgaggccgatgagaagatccgcaccttccagaaggatgcggcggcgcgg
gccggcatcttccatcacctcatcaccctgccgacctaccacacggccgccctgtcgacc
gacaaccttgccaaggaatatttcggcgaggcgggcatgctcggctatgtcgcgggtgtc
cagcgcaaggaaatccgccagggcatcgcctgcgtcaagcaccagaacatgtccggttcg
gacattggcgatgatcacaaggaatatttcgcgggtgaagcggcgctgaaggcgggcggc
atccacaacacgatgaatcagtttgcggcctga

DBGET integrated database retrieval system