KEGG   Sphingobium japonicum: SJA_C1-28980Help
Entry
SJA_C1-28980      CDS       T01201                                 

Gene name
cyc
Definition
(GenBank) cytochrome c
  KO
K08738  cytochrome c
Organism
sjp  Sphingobium japonicum
Pathway
sjp01100  Metabolic pathways
sjp01120  Microbial metabolism in diverse environments
sjp02020  Two-component system
Brite
KEGG Orthology (KO) [BR:sjp00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    SJA_C1-28980 (cyc)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cytochrom_C Cytochrome_CBB3 Cytochrom_C550
Motif
Other DBs
NCBI-ProteinID: BAI97732
NITE: SJA_C1-28980
UniProt: D4Z550
Position
1:2895306..2895929
Genome map
AA seq 207 aa AA seqDB search
MGDRFNTAAGWALFAGIIALGGAIVSSKFFHEERPEKMGYAIEGVEAEGEGGAASGPGLN
TLLASADVAAGEKVFAKCAACHTINQGGANGIGPNLYGTVGEPIGQGKGGFAFSDALKSK
GGNWTFENLDHWLTSPREFAPGTKMTFAGLGNPADRANLIAWLNTQGSNLPLPAADAAPA
AGGDNAAAEGGNASANAAEAPAANAAE
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
atgggcgatcgtttcaacaccgctgccggttgggcgttgttcgcgggtatcatcgcgctg
ggcggtgccatcgtcagttccaaattcttccatgaggaacggcccgagaaaatgggctac
gccatcgaaggcgtcgaagcggaaggcgaaggcggagcggccagcggccccggcctcaac
accctgctcgccagcgcggacgtcgcggcgggcgaaaaggtcttcgccaagtgcgcggcc
tgccacaccatcaaccagggcggcgccaacggcatcggccccaacctctacggcacggtt
ggcgagccgatcggccagggcaagggcggcttcgccttctccgacgcgctcaagagcaag
ggcggcaactggacgttcgagaatctcgatcactggctgaccagcccgcgtgaattcgcg
cccggcaccaagatgaccttcgcgggcctgggcaacccggccgaccgcgccaatctgatc
gcctggctgaacacccagggttcgaacctgccgctgcccgccgccgatgcggccccggca
gccggcggcgacaatgccgctgccgagggcggcaatgcctccgccaacgcggcagaggcg
cccgccgccaacgccgccgaataa

DBGET integrated database retrieval system