KEGG   Sphingobium japonicum: SJA_C1-28980Help
Entry
SJA_C1-28980      CDS       T01201                                 

Gene name
cyc
Definition
cytochrome c
Orthology
K08738  
cytochrome c
Organism
sjp  Sphingobium japonicum
Pathway
Sulfur metabolism
Metabolic pathways
Two-component system
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:sjp00920]
Environmental Information Processing; Signal transduction; Two-component system [PATH:sjp02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
1:2895306..2895929
Genome map
AA seq 207 aa AA seqDB search
MGDRFNTAAGWALFAGIIALGGAIVSSKFFHEERPEKMGYAIEGVEAEGEGGAASGPGLN
TLLASADVAAGEKVFAKCAACHTINQGGANGIGPNLYGTVGEPIGQGKGGFAFSDALKSK
GGNWTFENLDHWLTSPREFAPGTKMTFAGLGNPADRANLIAWLNTQGSNLPLPAADAAPA
AGGDNAAAEGGNASANAAEAPAANAAE
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
atgggcgatcgtttcaacaccgctgccggttgggcgttgttcgcgggtatcatcgcgctg
ggcggtgccatcgtcagttccaaattcttccatgaggaacggcccgagaaaatgggctac
gccatcgaaggcgtcgaagcggaaggcgaaggcggagcggccagcggccccggcctcaac
accctgctcgccagcgcggacgtcgcggcgggcgaaaaggtcttcgccaagtgcgcggcc
tgccacaccatcaaccagggcggcgccaacggcatcggccccaacctctacggcacggtt
ggcgagccgatcggccagggcaagggcggcttcgccttctccgacgcgctcaagagcaag
ggcggcaactggacgttcgagaatctcgatcactggctgaccagcccgcgtgaattcgcg
cccggcaccaagatgaccttcgcgggcctgggcaacccggccgaccgcgccaatctgatc
gcctggctgaacacccagggttcgaacctgccgctgcccgccgccgatgcggccccggca
gccggcggcgacaatgccgctgccgagggcggcaatgcctccgccaacgcggcagaggcg
cccgccgccaacgccgccgaataa

DBGET integrated database retrieval system