KEGG   Sphingobium japonicum: SJA_C1-33750Help
Entry
SJA_C1-33750      CDS       T01201                                 

Definition
(GenBank) putative diguanylate cyclase
  KO
K13590  
diguanylate cyclase [EC:2.7.7.65]
Organism
sjp  Sphingobium japonicum
Brite
Enzymes [BR:sjp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.65  diguanylate cyclase
     SJA_C1-33750
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NITE: 
UniProt: 
Position
1:complement(3359100..3360263)
Genome map
AA seq 387 aa AA seqDB search
MTGASSSANAQHGLTDRLARWARGLSGKADDEAMDLPEQPQRARHGSASSREIIRRRKLY
EDIGDFLFAHDLDLTPLNFGVAHDYLTGSHIGVEKAVKAVLTERGKITNGWVENVAAEQR
NDEVTPEALASMLDKVEENLSQFTGLMTESRNSAKDYGAALQEEVKGLAAGSDSQPVLAR
LVALTRSMVEKTRQVETQLRDNQKQTQLLKSNLESARRAAEHDHLTGLPNRRAFEGTLRE
ELAQAQKEGQPLAVAFCDIDHFKLINDTHGHDTGDRVLKFVAGLLSKASNDQCHVARHGG
EEFVMLFRGKTAAEACEAVDGVRQDLSTRSLVNRSNGERMERVSFSAGVANVLAYEDPRA
ALKAADRALYLAKEHGRNRVYLAAELD
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
atgactggggcatcatcttccgcaaacgcgcaacatggtctgaccgaccgcctggcccgc
tgggcccgcggcctgtccggcaaggccgacgacgaagccatggacctgccggagcagccg
cagcgcgcccggcacggcagcgcttccagccgggaaatcatccggcgccgcaagctgtac
gaggatataggcgacttccttttcgcccatgacctggacctgacgccgctcaatttcggc
gtggcccatgattatctgaccggatcgcatatcggcgtggaaaaggccgtgaaggcggtg
ctgaccgaacgcggcaagatcaccaacggctgggtcgaaaatgtcgccgccgaacagcgc
aacgacgaagtcacgcccgaagcgcttgcctccatgctcgacaaggtcgaggaaaatctg
tcgcaattcaccggcctgatgaccgaatcgcgcaattccgccaaggattatggcgcggcg
ttgcaggaagaggtgaagggcctggccgccggatcggacagccagccggtgctggcgcgc
ctggtggcgctgacccggtccatggtggaaaagacccggcaggtcgaaacacagcttcgc
gacaatcagaagcagacgcaactcctgaaatccaatctggaaagcgcgcgccgcgccgcc
gagcacgaccatctgaccggcctgcccaatcgccgcgccttcgaaggcacgctgcgcgag
gaactggcccaggcgcagaaggaggggcagccgctggccgtcgccttttgcgacatcgac
catttcaagctgatcaacgacacccatggccacgacaccggcgaccgggtgctgaaattc
gtggcgggactgctctcaaaggcaagcaacgaccaatgccatgtcgcgcgccatggcggc
gaggaattcgtcatgctgttccgcggcaagacggcggccgaagcctgcgaggcggtggac
ggcgtgcggcaggatctgtccacccgcagcctcgtcaaccgttccaatggcgagcggatg
gaaagggtcagcttttccgccggagtcgccaatgtgctggcctatgaagacccccgcgcc
gcgctcaaagcggcggaccgggcgctctacctggccaaggaacatggccgcaaccgggtc
tacctggccgccgaactggattga

DBGET integrated database retrieval system