KEGG   Sphingobium japonicum: SJA_C1-33750Help
Entry
SJA_C1-33750      CDS       T01201                                 

Definition
putative diguanylate cyclase
Orthology
K13590  
diguanylate cyclase
Organism
sjp  Sphingobium japonicum
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
1:complement(3359100..3360263)
Genome map
AA seq 387 aa AA seqDB search
MTGASSSANAQHGLTDRLARWARGLSGKADDEAMDLPEQPQRARHGSASSREIIRRRKLY
EDIGDFLFAHDLDLTPLNFGVAHDYLTGSHIGVEKAVKAVLTERGKITNGWVENVAAEQR
NDEVTPEALASMLDKVEENLSQFTGLMTESRNSAKDYGAALQEEVKGLAAGSDSQPVLAR
LVALTRSMVEKTRQVETQLRDNQKQTQLLKSNLESARRAAEHDHLTGLPNRRAFEGTLRE
ELAQAQKEGQPLAVAFCDIDHFKLINDTHGHDTGDRVLKFVAGLLSKASNDQCHVARHGG
EEFVMLFRGKTAAEACEAVDGVRQDLSTRSLVNRSNGERMERVSFSAGVANVLAYEDPRA
ALKAADRALYLAKEHGRNRVYLAAELD
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
atgactggggcatcatcttccgcaaacgcgcaacatggtctgaccgaccgcctggcccgc
tgggcccgcggcctgtccggcaaggccgacgacgaagccatggacctgccggagcagccg
cagcgcgcccggcacggcagcgcttccagccgggaaatcatccggcgccgcaagctgtac
gaggatataggcgacttccttttcgcccatgacctggacctgacgccgctcaatttcggc
gtggcccatgattatctgaccggatcgcatatcggcgtggaaaaggccgtgaaggcggtg
ctgaccgaacgcggcaagatcaccaacggctgggtcgaaaatgtcgccgccgaacagcgc
aacgacgaagtcacgcccgaagcgcttgcctccatgctcgacaaggtcgaggaaaatctg
tcgcaattcaccggcctgatgaccgaatcgcgcaattccgccaaggattatggcgcggcg
ttgcaggaagaggtgaagggcctggccgccggatcggacagccagccggtgctggcgcgc
ctggtggcgctgacccggtccatggtggaaaagacccggcaggtcgaaacacagcttcgc
gacaatcagaagcagacgcaactcctgaaatccaatctggaaagcgcgcgccgcgccgcc
gagcacgaccatctgaccggcctgcccaatcgccgcgccttcgaaggcacgctgcgcgag
gaactggcccaggcgcagaaggaggggcagccgctggccgtcgccttttgcgacatcgac
catttcaagctgatcaacgacacccatggccacgacaccggcgaccgggtgctgaaattc
gtggcgggactgctctcaaaggcaagcaacgaccaatgccatgtcgcgcgccatggcggc
gaggaattcgtcatgctgttccgcggcaagacggcggccgaagcctgcgaggcggtggac
ggcgtgcggcaggatctgtccacccgcagcctcgtcaaccgttccaatggcgagcggatg
gaaagggtcagcttttccgccggagtcgccaatgtgctggcctatgaagacccccgcgcc
gcgctcaaagcggcggaccgggcgctctacctggccaaggaacatggccgcaaccgggtc
tacctggccgccgaactggattga

DBGET integrated database retrieval system