KEGG   Sphingobium japonicum: SJA_C2-00570Help
Entry
SJA_C2-00570      CDS       T01201                                 

Definition
putative phosphatase
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
sjp  Sphingobium japonicum
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:sjp00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    SJA_C2-00570
Enzymes [BR:sjp01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     SJA_C2-00570
Transfer RNA biogenesis [BR:sjp03016]
 Eukaryotic Type
  tRNA degradation factors
   Rapid tRNA decay (RTD) pathway factors
    SJA_C2-00570
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
2:complement(56422..57159)
Genome map
AA seq 245 aa AA seqDB search
MTDAELAAHLAEVAGRILVNVRESGLFGPAALGKAGDQTANQFLCRALRETRPEDGLLSE
EEKDDEARLTKSRVWIVDPVDGTREYGEARADWAVHVGLAMDGRPAAGAVALPGLNGGTL
LRSDQPVPIPPAPEKLRMVISRTRPAKEAVAVAERLDAELVPMGSAGAKAMAVILGQADI
YLHSGGQYEWDSLAPVAVAQAHGLHCSRIDGSPLIYNQRDVYLPDLLICRKDHADKVLHL
IADLP
NT seq 738 nt NT seq  +upstreamnt  +downstreamnt
atgaccgacgccgaactggccgcgcatctggctgaggtggccggacgcatattggtcaat
gtgcgggaaagcggcctgttcggtcccgccgcgctgggcaaggcgggcgaccagaccgcc
aaccagttcctctgccgcgccctgcgggagacgcggcccgaagacggcctgctgtcggag
gaggagaaggacgatgaggcgcgcctgaccaaaagccgggtctggatcgtcgacccggtc
gacggcacccgcgaatatggcgaggcgcgggccgactgggccgtgcatgtcggcctcgcc
atggacggccgcccggcggcgggcgcggtcgcgctgcccggcctgaacgggggcaccttg
ctgcgctcggaccagccggtccccatcccgcccgcgccggaaaagctgcgcatggtcata
tcccgcacccgccccgccaaggaggcggtcgcggtggccgaacgcctcgacgccgaactg
gtgccgatgggttctgcgggggccaaggcgatggcggtgatattgggccaggccgacatc
tacctgcacagcggcggccaatatgaatgggacagcctggcccctgtcgccgtcgcccag
gcccacggcctccactgctcccgcatcgacggctcccccctcatctacaaccagcgcgac
gtctacctccccgacctgctcatctgccgcaaagaccacgccgacaaagtgctgcacctg
atagcggacctaccctga

DBGET integrated database retrieval system