KEGG   Sphingobium japonicum: SJA_C2-00760Help
Entry
SJA_C2-00760      CDS       T01201                                 

Gene name
pldB
Definition
lysophospholipase (EC:3.1.1.5)
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
sjp  Sphingobium japonicum
Pathway
Biosynthesis of unsaturated fatty acids
Brite
KEGG Orthology (KO) [BR:sjp00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    SJA_C2-00760 (pldB)
Enzymes [BR:sjp01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     SJA_C2-00760 (pldB)
   3.1.2  Thioester hydrolases
    3.1.2.-  
     SJA_C2-00760 (pldB)
Lipid biosynthesis proteins [BR:sjp01004]
 Fatty acid synthase
  Component type
   SJA_C2-00760 (pldB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
2:complement(78622..79323)
Genome map
AA seq 233 aa AA seqDB search
MKAGRRSIYVGAAAIVQLLTACSGEPAADNHAAPSVQAGNAAAPVADGKLVLAFGDSLYA
GYGVAQNESFPFRLEQALKAQGLAVQVRNAGVSGETSLGGMQRLAFTLDGLPRKPDLLLL
DLGGNDMLRGLPPEDSEKNLRAILDELKRRQIPVLLTGMLAAPNMGKDYGAKFDAIYPRL
AKDYGLPLYPFFLDGVIGDPKLMQADSIHPNPAGVNIVVGRIAPVVAGLLKDA
NT seq 702 nt NT seq  +upstreamnt  +downstreamnt
atgaaggcgggaagacggtcaatatatgtgggcgcggcggcgattgtgcaattgctcacc
gcctgttcgggcgaacccgccgccgacaatcatgccgcgccgtccgttcaggccggtaac
gcggccgccccggtcgcggacggcaagctggtgctggccttcggcgacagcctttatgcg
ggctatggcgtggcccagaatgaaagcttccccttccgcctggaacaggcgctgaaggcg
caggggctggcggttcaggtccgcaatgccggggtctccggcgaaacctccttgggcggc
atgcagcgcctggccttcacgctggacggcctgccgcgcaagcccgacctgctgctgctc
gacctgggcggcaacgacatgctgcgcggcctgccgccggaggacagcgagaagaatctg
cgcgccatattggacgaactgaaacggcggcagatccccgtgctgctcaccggcatgctg
gccgcgcccaatatgggcaaggattatggcgcgaagttcgacgccatctatccccggctg
gcgaaggattacggcctgccgctctaccccttcttcctggacggcgtgatcggcgatccc
aagctgatgcaggccgattccatccaccccaatcccgccggtgtgaacatcgtcgtcggc
aggatcgcgccggtcgtcgcgggcttgctcaaggacgcataa

DBGET integrated database retrieval system