KEGG   Sphingobium japonicum: SJA_C2-00910Help
Entry
SJA_C2-00910      CDS       T01201                                 

Definition
cytochrome c2
Orthology
K08738  
cytochrome c
Organism
sjp  Sphingobium japonicum
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Brite
KEGG Orthology (KO) [BR:sjp00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    SJA_C2-00910
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    SJA_C2-00910
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
2:96718..97116
Genome map
AA seq 132 aa AA seqDB search
MKTWIFAAGIGAVIAGAAVAAPAPKGNAAHGQQLFARCAACHKVGPNPARAMGPSLNGVV
GRAAGSQGGYGYSPAMKASGIKWDETSIDKLLQGPSKLVPGTKMIFPGMAAAQDRADIIA
YLKQFGADGRKK
NT seq 399 nt NT seq  +upstreamnt  +downstreamnt
gtgaagacttggatattcgctgcgggcatcggcgcggtgatcgccggcgcggcggtcgcc
gcccccgcgccgaagggaaatgccgcgcatgggcagcagcttttcgcgcgctgcgccgcc
tgccacaaggtcgggccgaacccggcgcgcgccatggggccgtcgctgaacggcgtggtc
ggccgggcggcgggcagccaaggcggctatggctattcgcccgcgatgaaggcgtcgggc
atcaaatgggacgagaccagcatcgacaagctgctgcaaggcccgtcgaagctggtcccc
ggcacgaagatgatcttccccggcatggccgccgcgcaggatcgcgccgacatcatcgcc
tatctgaaacaatttggcgcggatggtaggaagaagtga

DBGET integrated database retrieval system