KEGG   Sphingobium japonicum: SJA_C2-02020Help
Entry
SJA_C2-02020      CDS       T01201                                 

Definition
putative cellulase (EC:3.2.1.4)
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
sjp  Sphingobium japonicum
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sjp00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    SJA_C2-02020
Enzymes [BR:sjp01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     SJA_C2-02020
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
2:complement(237974..239002)
Genome map
AA seq 342 aa AA seqDB search
MRVATRLAMAPLLMLLALPLTAEQPAAGQPPLSGVNIAGGEFNSARKPGVFGKDYIYPDA
RTAQPFIDMGMRIVRVPILWERVQPAPLKPLSTTEMALIDKSLASLAPFRTIVLDVHNYG
RYNGQRLDQISNGSAMLADLWQRLAEHYKGNGAVAFGLMNEPYGMTPAAWRSLADGSVAA
IRRTGAANLILVPGSKYSGAHSWTTGGSNSNALAFADFRDPGGNYAFEMHQYLDADSSGT
ATSCVSPDLIDARLTGATTWLRTNGHRGFLGEFGAPPDDNCLRALDVLLAHLRANGDVWM
GWTYWAGGAWWGARYPMSVQPTGGPRPQAAVLSKHIVAREPR
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgagggtggcgactcgcctcgccatggcgccgctgctgatgctcctggccctgccgctg
accgccgagcagcctgccgccgggcaaccgcccctgtcgggcgtcaacatagcaggcggg
gaattcaattccgcgcgcaagcccggcgtcttcggcaaggattatatctatcccgacgca
aggacggcccagcccttcatcgacatggggatgcggatcgtccgcgtgccgatcctctgg
gaacgggtgcagccggcgccgctgaagccgctctccacgacggagatggccctgatcgac
aagtcgctcgccagtctggcgccgttccggaccatcgtgctcgacgtgcataattacggc
cggtacaacggccagcggctggaccagatttccaatgggtcggcgatgctggccgatctg
tggcagcggctggcggaacattacaagggcaatggcgccgtcgccttcggcctgatgaac
gagccctatggcatgacgccagccgcctggcggtcgctggcggacggcagcgtcgcggcg
atccggcggacgggggccgccaatctcatcctcgtgccgggttccaaatatagcggcgcg
catagctggaccacgggcggatcgaactccaacgcgctcgccttcgccgattttcgcgat
cccggcggcaattatgcgttcgagatgcaccaatatctggatgccgacagttccggcacg
gcgacgagctgcgtcagcccggacctgatcgacgcgcggctgacgggcgcgacgacatgg
ctgcggaccaatggccatcgcggcttcctgggcgaattcggtgcaccgcccgacgacaat
tgcctgcgcgcgctggacgttctgctcgcccatttgcgcgccaatggcgatgtctggatg
ggatggacctattgggcgggcggcgcctggtggggcgcccgctatccgatgagcgttcag
ccgaccggcggcccccgtccgcaggccgcggtgctcagcaagcatatcgttgcaagggag
ccaagatga

DBGET integrated database retrieval system