KEGG   Sphingobium japonicum: SJA_C2-05100Help
Entry
SJA_C2-05100      CDS       T01201                                 

Gene name
adh
Definition
putative alcohol dehydrogenase (EC:1.1.1.1)
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
sjp  Sphingobium japonicum
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:sjp00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    SJA_C2-05100 (adh)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SJA_C2-05100 (adh)
  Lipid metabolism
   00071 Fatty acid degradation
    SJA_C2-05100 (adh)
  Amino acid metabolism
   00350 Tyrosine metabolism
    SJA_C2-05100 (adh)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    SJA_C2-05100 (adh)
   00626 Naphthalene degradation
    SJA_C2-05100 (adh)
Enzymes [BR:sjp01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     SJA_C2-05100 (adh)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
2:complement(591581..592714)
Genome map
AA seq 377 aa AA seqDB search
MDGRSDGSMTIRGAILETSDAPRPYADSRPIRIGTLDLTPPGPGEILVKVEAASLCHSDL
SVINGNRRRPLPMLLGHESSGRVVALGPDVDDLALGQRVVLTFMPRCGACDACRTEGRIP
CTRGTAANGAGTLLDGDVHLSECGHPVLHHLGVSAFADHLVAHRSSAVPVGDDVPPDVAA
LLGCAVLTGGGALLNEARPTEADVVAIIGLGGVGMAALITAKALRPRRIVAIDALPDKLA
LARSLGADEALSPQDAVDRGIRADIVMECAGHPKAFETAFAITAPGGTTVTVGLPAPGAM
AQISPLQVTAEARRIVGSYLGSSVPRRDIPFLERLWREGRLPVERLISRRIGLEDINAAF
DALASGDQLRQVIMFDA
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atggatggacggagcgacgggtcgatgacgatccggggcgcgatcctggaaacgtcggac
gcgccgcgcccctatgccgacagccggccgatccggatcggcacgctggacctgacgccg
cccggccccggcgagatattggtcaaggtcgaggcggcgagcctctgccattcggacctg
tccgtcatcaacggaaaccgcaggcgcccgctgcccatgctgctgggacatgaatccagc
gggcgcgtcgtcgccctggggccggatgtcgacgacctcgccctgggacagcgcgtcgtc
ctcaccttcatgccccgctgcggcgcctgcgacgcatgccggactgaagggcgcattccc
tgcacccgcggcaccgccgccaacggggcggggacgctgctcgacggcgacgtgcacctc
agcgaatgcggccaccccgtcctccaccatctgggggtctccgccttcgcggatcacctg
gtcgcgcatcgcagttccgccgtcccggtgggcgacgacgttccgccggacgtggcggcg
ctgctgggctgcgccgtgctcaccggcggcggcgcgctcctcaacgaggcgcggccgacc
gaggcggacgtggtggcgatcatcggcctgggcggcgtcggcatggccgcgctcatcacc
gcgaaggcgctgcgtccgcgccggatcgtcgcgatcgacgcgcttccggacaagctcgcc
ctcgcccgttcgctgggcgccgacgaggcgctgtcgccgcaggacgccgtcgaccggggg
atcagggccgacatcgtcatggaatgcgccggccatcccaaggcgttcgaaaccgccttc
gccatcaccgcgcccggcggcacgaccgtgacggtcggcctgcccgcgcccggcgccatg
gcgcagatatcgcccttgcaggtgaccgccgaggcgcgccgcatcgtcggcagctatctt
ggttcgtcggttccccggcgcgacattccgttcctggaaaggctgtggcgcgaaggccgg
ctgccggtcgagcggctgatttcgcgccgcatcgggctggaggacatcaacgccgccttc
gacgccctggcatcgggcgaccagcttcgccaggtcatcatgttcgatgcctag

DBGET integrated database retrieval system