KEGG   Sphingobium japonicum: SJA_C2-05480Help
Entry
SJA_C2-05480      CDS       T01201                                 

Definition
(GenBank) putative endoglucanase/cellulase
  KO
K20542  
endoglucanase [EC:3.2.1.4]
Organism
sjp  Sphingobium japonicum
Brite
Enzymes [BR:sjp01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     SJA_C2-05480
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NITE: 
UniProt: 
Position
2:630799..631824
Genome map
AA seq 341 aa AA seqDB search
MSNCVMGFERRAILTALAFALTTGCARARPSDGLMLDPTLWQGYKTRFLTPEGRIVDNGN
GGVSHSEGQGYGMALAQAAGDGAAFEGMARWTAQTLLRKDVALHSWRYTPGRADPVADPN
NATDGDLLIAWALLMAGRRWGKPDYLQQSAAIRGAVAQKLIVQRHGFTLLLPGLVGFAKA
DRVIVNPSYYVWPAIDAFARLEPRIWGPLAADGMKILKAARFGPSGLPADWLDIKGKGVV
EPAEGRDPVFGFEGIRVPLYCLMSGRRGACDAIARYWLALVRAGKPLPAWVNVVTGETAP
YALSAGATAIAGRLLNRNLPAGGVDQDYYAATLGLMNQMRI
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaactgcgtcatgggatttgaacggcgggcgatcctgaccgccctcgcctttgct
ctcacgaccggctgcgcccgcgccagaccctcggacggcctgatgctcgatcccacgctc
tggcagggctacaagacccgcttcctgacgccggagggcaggatcgtcgacaatggcaat
ggcggcgtcagccatagcgagggccagggatatggcatggcgctggcgcaggcggcgggc
gacggcgcggccttcgagggcatggcgcgctggaccgcccagaccctgttgcgcaaggac
gtggcgctgcatagctggcgctacacgcccggccgcgccgatccggtggccgatcccaat
aatgcgaccgacggcgacctgctgatcgcctgggcgctgctgatggcgggccgccgctgg
ggcaagccggactatctccagcaatcggcggcgatccggggcgctgtcgcgcagaagctg
atcgtgcagcgccacggcttcaccctgctgctgccgggcctggtcggcttcgccaaggcg
gacagggtgatcgtcaacccatcctattatgtctggccggcgatagacgccttcgcccgg
ctggaaccgcgcatctggggtccgttggcggccgatgggatgaagatcctgaaggcggcg
cgcttcggcccatcgggcctgcccgccgactggctcgacatcaagggcaagggcgtggtc
gaaccggcggagggacgcgatcccgtcttcggcttcgagggcatccgcgtcccgctctac
tgcctgatgagcggacggcgcggcgcatgcgacgcgatcgcgcgctattggctcgccctc
gtccgcgccggcaagccgctgcccgcctgggtgaatgtggtcacgggcgaaaccgcgccc
tatgcgctttccgccggcgccaccgccatcgccggacgcctgctgaaccgcaacctgccg
gccggcggcgtcgatcaggactattatgccgcaacgctgggactgatgaaccagatgcgg
atttga

DBGET integrated database retrieval system