KEGG   Sphingobium japonicum: SJA_C2-05480Help
Entry
SJA_C2-05480      CDS       T01201                                 

Definition
putative endoglucanase/cellulase (EC:3.2.1.4)
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
sjp  Sphingobium japonicum
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sjp00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    SJA_C2-05480
Enzymes [BR:sjp01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     SJA_C2-05480
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
2:630799..631824
Genome map
AA seq 341 aa AA seqDB search
MSNCVMGFERRAILTALAFALTTGCARARPSDGLMLDPTLWQGYKTRFLTPEGRIVDNGN
GGVSHSEGQGYGMALAQAAGDGAAFEGMARWTAQTLLRKDVALHSWRYTPGRADPVADPN
NATDGDLLIAWALLMAGRRWGKPDYLQQSAAIRGAVAQKLIVQRHGFTLLLPGLVGFAKA
DRVIVNPSYYVWPAIDAFARLEPRIWGPLAADGMKILKAARFGPSGLPADWLDIKGKGVV
EPAEGRDPVFGFEGIRVPLYCLMSGRRGACDAIARYWLALVRAGKPLPAWVNVVTGETAP
YALSAGATAIAGRLLNRNLPAGGVDQDYYAATLGLMNQMRI
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaactgcgtcatgggatttgaacggcgggcgatcctgaccgccctcgcctttgct
ctcacgaccggctgcgcccgcgccagaccctcggacggcctgatgctcgatcccacgctc
tggcagggctacaagacccgcttcctgacgccggagggcaggatcgtcgacaatggcaat
ggcggcgtcagccatagcgagggccagggatatggcatggcgctggcgcaggcggcgggc
gacggcgcggccttcgagggcatggcgcgctggaccgcccagaccctgttgcgcaaggac
gtggcgctgcatagctggcgctacacgcccggccgcgccgatccggtggccgatcccaat
aatgcgaccgacggcgacctgctgatcgcctgggcgctgctgatggcgggccgccgctgg
ggcaagccggactatctccagcaatcggcggcgatccggggcgctgtcgcgcagaagctg
atcgtgcagcgccacggcttcaccctgctgctgccgggcctggtcggcttcgccaaggcg
gacagggtgatcgtcaacccatcctattatgtctggccggcgatagacgccttcgcccgg
ctggaaccgcgcatctggggtccgttggcggccgatgggatgaagatcctgaaggcggcg
cgcttcggcccatcgggcctgcccgccgactggctcgacatcaagggcaagggcgtggtc
gaaccggcggagggacgcgatcccgtcttcggcttcgagggcatccgcgtcccgctctac
tgcctgatgagcggacggcgcggcgcatgcgacgcgatcgcgcgctattggctcgccctc
gtccgcgccggcaagccgctgcccgcctgggtgaatgtggtcacgggcgaaaccgcgccc
tatgcgctttccgccggcgccaccgccatcgccggacgcctgctgaaccgcaacctgccg
gccggcggcgtcgatcaggactattatgccgcaacgctgggactgatgaaccagatgcgg
atttga

DBGET integrated database retrieval system