KEGG   Sphingobium japonicum: SJA_P1-00940Help
Entry
SJA_P1-00940      CDS       T01201                                 

Definition
putative asparagine synthase
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
sjp  Sphingobium japonicum
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sjp00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    SJA_P1-00940
Enzymes [BR:sjp01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     SJA_P1-00940
Peptidases [BR:sjp01002]
 Cysteine Peptidases
  Family C44
   SJA_P1-00940
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
pCHQ1:complement(73267..75012)
Genome map
AA seq 581 aa AA seqDB search
MALRYVIVVGSAAARARIRPQDDPEFALRELFEAPQFSIYAADGTSAVTNKRWSSAVIGH
LFWTVQPQRVVELDGALAERVQKSSGHEFVERHWGSYVAVFGGNGADEVHILRDPLETAP
CYYFRCDELWLVASDIATARQFTEPPASIDWSAITQQLLRPDLRTATTCISGVTELPGGH
RLTLRQDGSKLEELWSPAKFARPRDNVIGKQEAIERVRRVTLNSVHAWASCYRNILIQIS
GGLDSSILAAALRGNRAQLSALTIATTQPEGDERDHASLVADHLGFPLQDAFFDPRRVDI
TVCDGAHLPRPCARSHVQETDRLTLLAAKAVGAEVVFNGNAGDAVFCFLQSASPVADRLL
ADGIGGALQTSVDVSHITGVGIWSVLHRGISRAASWRRPYRWRMDTRYLHADVIAAGPDA
SAHPWLDSDATLLPGKLGQLAGLAQSHYHREGFASGGPIFMVSPLLSQPLVELCLAVPSW
MWCAGGVNRALARAAFERDLPRQIIQRRSKGSPDSLLLAILELNRPALIKWLCDGLLASR
NIIDVDSVRAQLARSGPTTGTDYIRLLDLADVEAWARSQPA
NT seq 1746 nt NT seq  +upstreamnt  +downstreamnt
atggccttgcgatacgtcatcgttgtcggatcagccgcagcgagagcgagaatccgtcca
caggacgacccggaattcgcacttcgcgaactctttgaagctccacagttcagtatctat
gcagccgacggaacaagcgcggttacgaacaagcgatggtcctcagcggtcatcgggcat
ctattctggacagtccaaccgcaacgagtggtggaactcgacggcgcactggcagagcgg
gtgcagaaaagctcgggacacgaattcgtcgagaggcactggggatcttatgtagcagtt
ttcggcggaaacggcgctgacgaagtccatattttgcgcgaccccctcgaaactgccccg
tgctattattttcgatgcgacgaactctggttggtagcgtcagacatcgcgactgcccgc
caattcacagagccgcctgcctcaatcgactggtcggcaatcacccagcagctcttgcgg
cccgatctgagaacggccacgacatgcatttcaggggtcaccgaattgcccggagggcac
cggctgacgttgagacaagatggatcaaagctggaggaactgtggtcgcctgcgaaattc
gcccgcccgcgagacaacgtgatcgggaagcaagaggcgatcgaacgtgtgcgtcgcgtg
acgctcaatagcgttcacgcttgggcctcctgctaccgtaacattcttatccagatatca
gggggtctcgatagctcgatccttgcggccgccttgcggggcaaccgagcgcaactttcc
gcattgacgatagcaacgacacaacccgagggtgacgaacgagaccatgcaagcctggtg
gcagaccatcttggatttccgcttcaggacgcatttttcgacccgcgaagggtcgatata
accgtctgcgacggcgcccatcttccgcgcccatgcgctcgctcccatgtgcaagaaacc
gaccgcttgaccctgcttgcggcgaaggccgtgggtgccgaagtcgttttcaacgggaac
gcaggagacgcggttttctgctttcttcaatcagccagtcccgttgccgatcggttgctt
gcggatggcattggcggtgccctccagacatccgtcgatgtcagccatatcaccggtgtg
ggaatatggtccgtgctacaccgtggaatctcgcgagcggcctcctggcgccggccctat
cgctggcggatggacacgagatatcttcacgccgacgtgatcgcggctggccccgatgcc
tcagcccatccctggcttgactctgatgccacgctgttgcctggcaaactgggacaactc
gccggcctcgcccaatcgcactatcatcgggaagggtttgcaagcggagggccgattttc
atggtgtcgcctcttctgtctcagccgctggtagaactttgccttgccgtaccaagctgg
atgtggtgcgcgggcggcgtcaatcgagccttggctcgagcagccttcgagcgagacctt
ccgcggcagatcatccagcgacgatccaagggaagtccggacagcctcctcctcgccatt
ctcgaattgaacaggcctgcgctgattaaatggctgtgcgacgggttgctcgccagccga
aacatcatcgatgtcgacagcgtccgggcccaacttgctcgatccggcccgacgaccggc
acggactatatccgccttcttgacctggccgacgtcgaggcgtgggccaggtcgcaacct
gcctag

DBGET integrated database retrieval system