KEGG   Sphingobium japonicum: SJA_P1-01010Help
Entry
SJA_P1-01010      CDS       T01201                                 

Definition
putative protein-disulfide isomerase
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
sjp  Sphingobium japonicum
Brite
Enzymes [BR:sjp01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     SJA_P1-01010
Secretion system [BR:sjp02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   SJA_P1-01010
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
pCHQ1:78284..79072
Genome map
AA seq 262 aa AA seqDB search
MTGAKRGLLAASAALAFVGLIAGPASAQSQSAADKDLAKAAAEAEQQLHQTFTNLKFDDF
GPAPVKGPIYQAIAGGKIIYYAPQSEHILLAAIYDKNGVNVTALAQDASTRRKLGVVDPA
KALVIGPAGAPTVIEFTDPDCPYCRALEKFWAVKEAEGKPVRRLVYFVSGIHPEAAAKAE
HILCSPDKAAEFKAIYAGAAPKELHKCLPGRSKVEADAEIVRQVGISGTPTLIVDGRVIS
GFQQGELEEFLSKPKQEGKAPQ
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgaccggcgcaaagcgaggtctcctcgcggcgagcgcagcactcgcgtttgtcggcctc
atcgcaggtccggcttccgcgcagtcgcaatcggcggcagacaaggatctcgcaaaggcg
gcggcggaagctgagcagcagctccatcagaccttcacgaacctcaagttcgacgatttc
ggcccggcgccggtcaaaggtccgatctaccaggcgatcgccggcggcaagatcatctat
tatgcgccgcagagcgagcacatcctgcttgccgcgatctacgataagaacggcgtcaat
gtgaccgcgcttgcgcaggatgccagcacgaggcgcaagctgggcgtggtcgatcctgca
aaggcgctggtcatcggtccagcgggtgcgccgacggtcatcgagttcacggatccggat
tgtccctattgccgcgcgctcgagaaattctgggcagtcaaggaagcggaaggcaagccg
gtccggcgcctggtctatttcgtgagcggcatccatccggaggcggccgcgaaagccgag
catatcctgtgctccccggacaaagcggcagagttcaaggcgatctacgccggagccgcg
cccaaagaactccataaatgccttcccggccggtcgaaggtcgaggccgatgctgaaatc
gtccgtcaggtcgggatcagcggcacccctacgttgatcgtcgacgggcgggtgatctcc
gggttccagcagggcgagctcgaggaattcctctcgaaacccaagcaggaggggaaggcc
ccgcagtag

DBGET integrated database retrieval system