KEGG   Sanguibacter keddieii: Sked_00450Help
Entry
Sked_00450        CDS       T01214                                 

Definition
(GenBank) Zn-dependent alcohol dehydrogenase
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
ske  Sanguibacter keddieii
Pathway
ske00010  Glycolysis / Gluconeogenesis
ske00071  Fatty acid degradation
ske00350  Tyrosine metabolism
ske00625  Chloroalkane and chloroalkene degradation
ske00626  Naphthalene degradation
ske01100  Metabolic pathways
ske01110  Biosynthesis of secondary metabolites
ske01120  Microbial metabolism in diverse environments
ske01130  Biosynthesis of antibiotics
ske01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:ske00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Sked_00450
  Lipid metabolism
   00071 Fatty acid degradation
    Sked_00450
  Amino acid metabolism
   00350 Tyrosine metabolism
    Sked_00450
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Sked_00450
   00626 Naphthalene degradation
    Sked_00450
Enzymes [BR:ske01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Sked_00450
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2
Motif
Other DBs
NCBI-ProteinID: ACZ20021
UniProt: D1BI47
Position
complement(45119..46165)
Genome map
AA seq 348 aa AA seqDB search
MQAVVFTDYKTFPSLQEVDKPSPGPGEVLLKVAGAGACHSDVSIYSHFEEGQPGAQKPGF
VLGHESSGWVESVGEGVSGFEVGDAYLVYGPIGCGHCAACSRGQDTYCENAATMPYLGTG
LGRDGGMAEYVTVPARNLVPLGDSDPVTAAPLADAALTPYHAIKLSLPNLAGGGRYALVV
GLGGLGQIAVQILTAITGATVIATDMKPEAMEKAAAAGAITVPSGPDQADRIREITGGKG
VDAAFDFVGVTPTIGLARSVMAQGSRLTVVGIAGGTAEWSFFTTPYESVITNTYWGTIEE
LHEVVALYRDGKIAPEVERFALADALDAYRKMEAGELTARAVVVPHGA
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atgcaggctgtcgtgttcacggactacaagaccttcccgtcgctccaggaggtcgacaag
ccgtcacccggccctggcgaggtcctgctcaaggtcgccggcgcgggcgcctgccactcc
gacgtgtcgatctacagccacttcgaggagggtcagcccggcgcgcagaagcccggcttc
gtcctcggccacgagagctccggctgggtcgagtccgtcggcgagggcgtctccggcttc
gaggtcggcgacgcgtacctcgtgtacggcccgatcggctgcggccactgcgcggcgtgc
tcgcgcggccaggacacctactgcgagaacgccgccaccatgccctacctgggcaccggc
ctgggccgcgacggcggcatggccgagtacgtcacggtccccgcgcgcaacctcgtgccg
ctcggcgactcggaccccgtgaccgccgcaccgctcgccgacgcagccctcacgccgtac
cacgcgatcaagctctccctgccgaacctcgcgggcggcgggcgctacgccctcgtcgtc
ggcctcggcgggctcgggcagatcgcggtgcagatcctcacggcgatcaccggcgcgacc
gtcatcgccacggacatgaagcccgaggccatggagaaggccgccgctgctggcgcgatc
accgtcccgagcggtccggaccaggccgaccgcatccgtgagatcaccgggggcaagggc
gtcgacgcggccttcgacttcgtcggggtcaccccgaccatcggactcgcacgctccgtc
atggcgcagggctcgcgcctcacagtggtcggcatcgccggcggcaccgccgagtggtcg
ttcttcacgacgccgtacgagtcggtcatcaccaacacctactggggcacgatcgaagag
ctccacgaggtcgtcgcgctgtaccgcgacggcaagatcgcgcccgaggtcgagcgcttc
gccctcgccgacgccctcgacgcctaccggaagatggaggccggcgagctcaccgcccgc
gcggtcgtcgtgccgcacggcgcgtga

DBGET integrated database retrieval system