KEGG   Sanguibacter keddieii: Sked_00680Help
Entry
Sked_00680        CDS       T01214                                 

Definition
transcriptional regulator/sugar kinase
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
ske  Sanguibacter keddieii
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:ske00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Sked_00680
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Sked_00680
   00052 Galactose metabolism
    Sked_00680
   00500 Starch and sucrose metabolism
    Sked_00680
   00520 Amino sugar and nucleotide sugar metabolism
    Sked_00680
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Sked_00680
   00524 Butirosin and neomycin biosynthesis
    Sked_00680
Enzymes [BR:ske01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Sked_00680
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
69227..70159
Genome map
AA seq 310 aa AA seqDB search
MSDRLVLALDIGGTNARGEVLDVRLGAPLVRADLPTPEQDGEATIATIESLCRLLLAGLS
ETDRARVQAVGLAVPGIIDAETGVVRLASNLGWSDEPVAARLSALLGLEVVLHHDVTAAG
LAEHRLGAGAGAPDLLAVFIGTGMAALVVTGGEVVSGGLHQAGEIGHMPVEQGGRPCPCG
QTGCLEMYASARAIGRAYGAVTGDVSATSLDVVTALGTDPRADAVWSEAMDWLAHGLLGP
ITLLSPVRIVLGGGLSASGAVLVDALRTRLDALSHVAAVPEIVTASLGQRAGVLGSGLAT
FAAIERTQLV
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgaccgcctggtcctcgcgctcgacatcggggggaccaacgcccggggcgaggtg
ctcgacgtgcgcctcggcgcacccctggtccgcgccgacctgcccacccccgagcaggac
ggcgaggccaccatcgcgaccatcgagtcgctgtgccggctgctgctcgccgggctctcc
gagaccgaccgcgcccgggtgcaggccgtcgggctcgccgtgcccgggatcatcgacgcc
gagaccggcgtggtgcgcctcgcgagcaacctcgggtggtcggacgagcccgtggccgcg
aggctgtccgcgctgctcgggctcgaggtcgtgctgcaccacgacgtcacggccgccggg
ctcgccgagcaccgcctcggtgccggcgcgggcgcgcccgacctgctcgccgtgttcatc
gggaccgggatggcggcgctcgtcgtcaccggcggcgaggtggtgtccggcggcctgcac
caggccggcgagatcgggcacatgcccgtcgagcagggcgggcgcccgtgcccgtgcggg
cagacggggtgcctcgagatgtacgcctcggcgcgagccatcggccgtgcctacggcgcg
gtcaccggggacgtctcggcgacctccctcgacgtggtcacggctctcggcacggacccc
cgggccgacgccgtgtggtccgaggccatggactggctcgcccacgggctcctcggcccc
atcacgctgctctcgcccgtgcgcatcgtgctcggcggagggctgtccgcgtccggcgcc
gtcctcgtcgacgcgctgcgcacccggctcgacgcgctgtcccacgtggccgcggtcccc
gagatcgtcaccgcgtcgctcgggcagcgggccggcgtgctcgggtcggggctcgcgacc
ttcgcggcgatcgagcgcacccagctggtgtga

  All links  
No link information was found.   
DBGET integrated database retrieval system