KEGG   Sanguibacter keddieii: Sked_00840Help
Entry
Sked_00840        CDS       T01214                                 

Definition
(GenBank) uroporphyrinogen-III synthase
  KO
K01719  uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
ske  Sanguibacter keddieii
Pathway
ske00860  Porphyrin and chlorophyll metabolism
ske01100  Metabolic pathways
ske01110  Biosynthesis of secondary metabolites
ske01120  Microbial metabolism in diverse environments
Module
ske_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:ske00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Sked_00840
Enzymes [BR:ske01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     Sked_00840
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HEM4 Trans_reg_C
Motif
Other DBs
NCBI-ProteinID: ACZ20057
UniProt: D1BI83
Position
complement(85629..86762)
Genome map
AA seq 377 aa AA seqDB search
MNAADDTSGVTEFSNDQLSGFRIGVTSDRRSDDLIAALERRGAQVMHAPALRIAPVEEDV
DLLADTRAILETPPDVMVVTTAYGMRRWSEAADAAGLGDPLTEVLQASRIFVRGPKARGA
VRAAGLDDVGIAHDERTSSVIDMLLDEGVDGLTVAVQLHGYTDGQQLERLRAGGARVLTV
EPYRWVKPDGAERLPRLIDAVCSRNLDVVTFTSAPAVDAFLTSAIEQGVLDQLLDALRTD
VVAAAVGPVTAGPLEVAGVTPIIPERFRMGALIRLVCEHLALHQVAEFPTALGQVQIRGR
SVVFDGRAGQLAPAPLALFRALAASKGAVLTRKDLMAHLPEAENEHALDMAMSRLRASLP
EPRLVATVVKRGYRLNV
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atgaacgctgccgacgacacgtccggtgtcaccgagttcagcaacgaccagctctcgggg
ttccggatcggcgtgacgtcggaccggcggtcggacgacctcatcgcggcgctcgagcgg
cgcggcgcgcaggtgatgcacgcccccgcgctgcgcatcgcgcccgtggaggaggacgtc
gacctgctcgcggacacccgggcgatcctggagacgccgcccgacgtcatggtggtcacc
acggcctacggcatgcgtcggtggagcgaggctgctgacgccgcgggcctcggcgacccg
ctcaccgaggtgctgcaggcctcccggatcttcgtccgcggtcccaaggcccgcggcgcg
gtccgcgcggcgggcctggacgacgtcggcatcgcgcacgacgagcgcacctcgtcggtg
atcgacatgctgctcgacgagggcgtcgacgggctgacggtggccgtccagctccacggg
tacacggacggccagcagctcgagcggctgcgtgccggcggggcgcgggtgctcaccgtc
gagccctaccgctgggtgaagcccgacggcgcggagcggctgccgaggctcatcgacgcg
gtgtgctcgcgcaacctcgacgtcgtcaccttcacgagcgccccggcggtcgacgcgttc
ctcacctcggcgatcgagcagggtgtcctcgaccagctgctcgacgcgttgcgcaccgac
gtggtggcggccgccgtcggtccggtgaccgcagggcctctcgaggtcgccggcgtgacg
ccgatcatccccgagcggttccgcatgggcgcgctcatccggctggtgtgcgagcacctc
gcgctgcaccaggtggccgagttccccaccgcgctggggcaggtgcagatccgcgggcgc
tcggtggtcttcgacggccgcgcgggccagctggcccccgccccgctcgcgctgttccgt
gccctcgccgcgagcaagggggccgtgctcacccgcaaggacctcatggcgcacctgccc
gaggccgagaacgagcacgccctcgacatggcgatgagccggctccgggcgtcgctgccc
gagccacgcctcgtggcgaccgtggtcaagcgggggtaccggctcaacgtgtga

DBGET integrated database retrieval system