KEGG   Sanguibacter keddieii: Sked_00840Help
Entry
Sked_00840        CDS       T01214                                 

Definition
uroporphyrinogen-III synthase
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
ske  Sanguibacter keddieii
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Heme biosynthesis, glutamate => protoheme/siroheme
Brite
KEGG Orthology (KO) [BR:ske00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Sked_00840
Enzymes [BR:ske01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     Sked_00840
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(85629..86762)
Genome map
AA seq 377 aa AA seqDB search
MNAADDTSGVTEFSNDQLSGFRIGVTSDRRSDDLIAALERRGAQVMHAPALRIAPVEEDV
DLLADTRAILETPPDVMVVTTAYGMRRWSEAADAAGLGDPLTEVLQASRIFVRGPKARGA
VRAAGLDDVGIAHDERTSSVIDMLLDEGVDGLTVAVQLHGYTDGQQLERLRAGGARVLTV
EPYRWVKPDGAERLPRLIDAVCSRNLDVVTFTSAPAVDAFLTSAIEQGVLDQLLDALRTD
VVAAAVGPVTAGPLEVAGVTPIIPERFRMGALIRLVCEHLALHQVAEFPTALGQVQIRGR
SVVFDGRAGQLAPAPLALFRALAASKGAVLTRKDLMAHLPEAENEHALDMAMSRLRASLP
EPRLVATVVKRGYRLNV
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atgaacgctgccgacgacacgtccggtgtcaccgagttcagcaacgaccagctctcgggg
ttccggatcggcgtgacgtcggaccggcggtcggacgacctcatcgcggcgctcgagcgg
cgcggcgcgcaggtgatgcacgcccccgcgctgcgcatcgcgcccgtggaggaggacgtc
gacctgctcgcggacacccgggcgatcctggagacgccgcccgacgtcatggtggtcacc
acggcctacggcatgcgtcggtggagcgaggctgctgacgccgcgggcctcggcgacccg
ctcaccgaggtgctgcaggcctcccggatcttcgtccgcggtcccaaggcccgcggcgcg
gtccgcgcggcgggcctggacgacgtcggcatcgcgcacgacgagcgcacctcgtcggtg
atcgacatgctgctcgacgagggcgtcgacgggctgacggtggccgtccagctccacggg
tacacggacggccagcagctcgagcggctgcgtgccggcggggcgcgggtgctcaccgtc
gagccctaccgctgggtgaagcccgacggcgcggagcggctgccgaggctcatcgacgcg
gtgtgctcgcgcaacctcgacgtcgtcaccttcacgagcgccccggcggtcgacgcgttc
ctcacctcggcgatcgagcagggtgtcctcgaccagctgctcgacgcgttgcgcaccgac
gtggtggcggccgccgtcggtccggtgaccgcagggcctctcgaggtcgccggcgtgacg
ccgatcatccccgagcggttccgcatgggcgcgctcatccggctggtgtgcgagcacctc
gcgctgcaccaggtggccgagttccccaccgcgctggggcaggtgcagatccgcgggcgc
tcggtggtcttcgacggccgcgcgggccagctggcccccgccccgctcgcgctgttccgt
gccctcgccgcgagcaagggggccgtgctcacccgcaaggacctcatggcgcacctgccc
gaggccgagaacgagcacgccctcgacatggcgatgagccggctccgggcgtcgctgccc
gagccacgcctcgtggcgaccgtggtcaagcgggggtaccggctcaacgtgtga

DBGET integrated database retrieval system